PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g25150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 69aa    MW: 7681.86 Da    PI: 9.9016
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g25150.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.12e-082381248
                      HHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding 12 lvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      l+ +++++G g+W++++   g  R+ k+c +rw +yl
  LOC_Os07g25150.1  2 LASYIQEHGAGNWRAVPTNTGVMRCSKSCPLRWTNYL 38
                      7899*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd001673.31E-4138No hitNo description
SuperFamilySSF466891.79E-15165IPR009057Homeodomain-like
PROSITE profilePS5129414.007142IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-12241IPR009057Homeodomain-like
PfamPF002491.2E-7238IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-74265IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MLASYIQEHG AGNWRAVPTN TGVMRCSKSC PLRWTNYLQP GIKRGNFTEQ EEKLIVHLQA  60
LLGNRSLP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.789011e-114callus| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329734741e-114
Expression AtlasB7E8L8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g25150.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g25150
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0634561e-112AK063456.1 Oryza sativa Japonica Group cDNA clone:001-115-G07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647840.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647838.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647837.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647836.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647835.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647834.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647833.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647832.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647831.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647830.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647829.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647828.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647827.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647826.11e-42PREDICTED: transcription factor MYB21 isoform X1
RefseqXP_015647825.11e-42PREDICTED: transcription factor MYB21 isoform X1
SwissprotQ9SCU71e-36MYB30_ARATH; Transcription factor MYB30
TrEMBLB7E8L81e-45B7E8L8_ORYSJ; cDNA clone:001-115-G07, full insert sequence
TrEMBLQ0D6W42e-44Q0D6W4_ORYSJ; Os07g0432800 protein (Fragment)
STRINGLOC_Os07g25150.14e-45(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP4047523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.17e-38myb domain protein 30