PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g24350.1
Common NameOSJNBa0052I14.29, P0409D09.43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HB-other
Protein Properties Length: 126aa    MW: 14391.9 Da    PI: 6.5142
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g24350.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.81.4e-2156107556
                       SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++t++q++ Le++Fe++ y+  ++r +LAkklg++erqVk+WFqNrR+++k
  LOC_Os07g24350.1  56 KRHTDDQIKHLESVFERCTYLGGNQRVQLAKKLGMEERQVKFWFQNRRTRKK 107
                       579***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-2141107IPR009057Homeodomain-like
PROSITE profilePS5007116.63349109IPR001356Homeobox domain
SuperFamilySSF466892.95E-1950107IPR009057Homeodomain-like
SMARTSM003894.1E-1651113IPR001356Homeobox domain
CDDcd000861.07E-1753107No hitNo description
PfamPF000466.2E-1956107IPR001356Homeobox domain
PRINTSPR000312.2E-68089IPR000047Helix-turn-helix motif
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PRINTSPR000312.2E-689105IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MDNGSQQESS DLHVHHLPIA SIIGVEDRTE EADDAAVDYH DDSSEGQDEV SNKRMKRHTD  60
DQIKHLESVF ERCTYLGGNQ RVQLAKKLGM EERQVKFWFQ NRRTRKKVAT WVDKIQLSVR  120
NGGSP*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ6ZF11
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g24350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g24350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149631e-109AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0056901e-109AP005690.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0052I14.
GenBankAP0042981e-109AP004298.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0409D09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954072.18e-17PREDICTED: homeobox-leucine zipper protein ROC8-like
TrEMBLQ6ZF115e-90Q6ZF11_ORYSJ; Uncharacterized protein
STRINGLOC_Os07g24350.11e-89(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
MonocotsOGMP149301619
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17920.13e-17homeodomain GLABROUS 12