PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g17160.1
Common NameOs07g0272500, OSNPB_070272500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family EIL
Protein Properties Length: 466aa    MW: 50264.2 Da    PI: 8.3602
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g17160.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3452.6e-1490226129265
                       .XX----STTS-HHHHHHHHHHHSSSSSS-TTS--T..TT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGG CS
              EIN3 129 rsseshslselqDTtlgSLLsalmqhcdppqrrfpl..ekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsp 219
                       rss    +s l D  l  + + lm+ c ppq  +pl  +  + pPWWPtG+e+ww+elg+ +    ppy+    l ka k     a +k + p
  LOC_Os07g17160.1  90 RSSLAMAVSGLADHVLERMVKVLMRKCHPPQALYPLigKSPLRPPWWPTGREQWWPELGAGA--VVPPYRPAPLLSKAEKEVAVVAMVKNLVP 180
                       5566667777888888888999*************95456799*************999764..4689**98899999986666788999*** PP

                       GHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX CS
              EIN3 220 tieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss 265
                       ++e++   +r   ++ ++++  e  a+   +  e++ +   ++h  
  LOC_Os07g17160.1 181 DFERLFMAVRMAPSVTSRITDAEARAWDDGVAGERETYMARHPHRT 226
                       ***************************9999999888888888743 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.3180.101.2E-3889224IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
PfamPF048733.7E-1794209No hitNo description
SuperFamilySSF1167682.22E-4494219IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MDASKKSVMT KEEQQLSPAA SPAAAVMTAE ADAINEEQDK AAAATTADHT APPPPPPAAA  60
AVADHAGEMD MASGSGVAHL APPAVAPAPR SSLAMAVSGL ADHVLERMVK VLMRKCHPPQ  120
ALYPLIGKSP LRPPWWPTGR EQWWPELGAG AVVPPYRPAP LLSKAEKEVA VVAMVKNLVP  180
DFERLFMAVR MAPSVTSRIT DAEARAWDDG VAGERETYMA RHPHRTTPTR AWKLMDSLKP  240
EAVRMKLKAP KPKPQVTIKV EDAAPFLTVS AAADPAAVEA AMGAIEAMRN SSKDPDAPYY  300
PMPSPLHGHN EVGPNDYPEN PAIWKEFNRK EGQLDLLRVG KKNDRMAISD RVDGGASGSG  360
PRKGYLVMKT YKKAQEYYRE LRNKGAMASG AGVKIEDDSE TESDNEDEKA NEKAKAKAKA  420
RAVYQQNKGV KTEDQSETES DNEDEQAKVM AKAKARVIPR PNKGI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-159520710121ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0N7KN89
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g17160.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g17160
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0051720.0AP005172.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBb0002J01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646400.10.0PREDICTED: uncharacterized protein LOC107276281
TrEMBLA0A0E0Q6I90.0A0A0E0Q6I9_ORYRU; Uncharacterized protein
TrEMBLA0A0N7KN890.0A0A0N7KN89_ORYSJ; Os07g0272500 protein
TrEMBLQ6Z4J60.0Q6Z4J6_ORYSJ; Putative uncharacterized protein
STRINGLOC_Os07g17160.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159701112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.12e-14ETHYLENE-INSENSITIVE3-like 3