PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g13260.1
Common NameOs07g0236700, OSNPB_070236700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Dof
Protein Properties Length: 333aa    MW: 32942.1 Da    PI: 10.1131
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g13260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.5e-3849107260
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       +e  lkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalrnvPvGgg r+nk+
  LOC_Os07g13260.1  49 PEPGLKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRNVPVGGGFRRNKR 107
                       56789****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-4033107IPR003851Zinc finger, Dof-type
PfamPF027012.8E-3253107IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.34853107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MTSASLLLAP RSPDMAAAGI LPVSGGGGAS SARPVSMAER ARMAKIPQPE PGLKCPRCDS  60
TNTKFCYFNN YSLTQPRHFC KACRRYWTRG GALRNVPVGG GFRRNKRGTK PSNSKKPAAA  120
VAGGVMAPPH AQLQLPFGFD GGGGGGHGSI IGGGGGGGAS RLGFPELSSL HAAAAVDYQL  180
GGGGGGDGLG LERQRLPHFP FLARSNAAVH PPPLMSTAAG VSYPFGDVAA GGLGGDMPAN  240
AASVAGSAGL ITQMASVKMD DIDNHPPPSA ATTTASSPIE FLGLRGSLQF WGGGGGHRGG  300
GDGAGGSAAP GGGGGGWSDL PAFDLSTSGN IL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.352040.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329785590.0
Expression AtlasA0A0P0X462-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g13260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g13260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0043030.0AP004303.2 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0407H12.
GenBankAK0685420.0AK068542.1 Oryza sativa Japonica Group cDNA clone:J013155H18, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645540.10.0PREDICTED: dof zinc finger protein DOF5.1 isoform X2
RefseqXP_015645541.10.0PREDICTED: dof zinc finger protein DOF5.1 isoform X3
RefseqXP_015645539.10.0PREDICTED: dof zinc finger protein DOF5.1 isoform X1
TrEMBLA0A0P0X4620.0A0A0P0X462_ORYSJ; Os07g0236700 protein (Fragment)
TrEMBLQ7XI700.0Q7XI70_ORYSJ; Os07g0236700 protein
STRINGLOC_Os07g13260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
MonocotsOGMP48932961
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.11e-46OBF-binding protein 3