PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g12340.1
Common NameLOC4342753, NAC67, Os07g0225300, OSJNBa0066H10.107, P0668C05.126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 277aa    MW: 30860.9 Da    PI: 6.4107
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g12340.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.7e-51171421128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeelv +yL+++++g+  ++  +i+e+d+y+++PwdLp+++  +++ewyfF++rd+ky++g+r+nra++sgyWkatg dk+vl
  LOC_Os07g12340.1  17 LPPGFRFHPTDEELVAHYLCPRAAGRAAPV-PIIAELDLYRHDPWDLPHRALFGRREWYFFTPRDRKYPNGSRPNRAAASGYWKATGADKPVL 108
                       79*************************999.88***************87778999************************************* PP

               NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +g++ g+kk Lvfy+g+ p+g+kt+W+mheyrl
  LOC_Os07g12340.1 109 H-NGRTAGIKKALVFYHGKPPRGVKTEWIMHEYRL 142
                       *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6313170IPR003441NAC domain
PROSITE profilePS5100558.91917170IPR003441NAC domain
PfamPF023653.2E-2718142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009038anatomypalea
PO:0001048developmental stagepalea development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MAAAKRRVRD AEADLNLPPG FRFHPTDEEL VAHYLCPRAA GRAAPVPIIA ELDLYRHDPW  60
DLPHRALFGR REWYFFTPRD RKYPNGSRPN RAAASGYWKA TGADKPVLHN GRTAGIKKAL  120
VFYHGKPPRG VKTEWIMHEY RLAKKGGAAA AAGAGALRLD DWVLCRLYNK KNEWEKMQSR  180
KEEEEAMAAA QSWGETRTPE SEVVDSDAFP EMDYSLPAAS FDDALLPKEE ARDDDWLMGM  240
SLDDLQGLGS LLQADDLSML APPPAAKTEP LGAPFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-9561764174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.55490.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329836900.0
Expression AtlasQ7EZT1-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaf blades. {ECO:0000269|PubMed:10660065}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g12340.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g12340
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0055160.0AP005516.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0066H10.
GenBankAP0045720.0AP004572.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0668C05.
GenBankAB0281820.0AB028182.1 Oryza sativa mRNA for OsNAC3 protein, complete cds.
GenBankAK0736670.0AK073667.1 Oryza sativa Japonica Group cDNA clone:J033052E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645028.10.0PREDICTED: NAC domain-containing protein 67
SwissprotQ7EZT10.0NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLA0A0E0Q5Q80.0A0A0E0Q5Q8_ORYRU; Uncharacterized protein
TrEMBLI1Q9520.0I1Q952_ORYGL; Uncharacterized protein
STRINGLOC_Os07g12340.10.0(Oryza sativa Japonica Group)
STRINGORGLA07G0064400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-78NAC domain containing protein 32
Publications ? help Back to Top
  1. Kikuchi K, et al.
    Molecular analysis of the NAC gene family in rice.
    Mol. Gen. Genet., 2000. 262(6): p. 1047-51
    [PMID:10660065]
  2. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]