PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g12130.1
Common NameLOC107281580, OsJ_23574, P0592C06.127
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 439aa    MW: 47468 Da    PI: 6.0743
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g12130.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.1e-16108154148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT eEde l + v+ +G + W+ Ia+ ++ gR +kqc++rw ++l
  LOC_Os07g12130.1 108 KGGWTREEDEVLRQMVRHHGDRKWAEIAKSLP-GRVGKQCRERWTNHL 154
                       688*****************************.************996 PP

2Myb_DNA-binding52.21.4e-16162202345
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        WT+eEd  l++a++ +G+  W++Ia+ ++ gR+++ +k++w+
  LOC_Os07g12130.1 162 IWTEEEDRMLIEAHQTYGNS-WSAIAKQLP-GRSENTIKNHWN 202
                       6*****************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129429.56103158IPR017930Myb domain
SuperFamilySSF466893.73E-31105201IPR009057Homeodomain-like
SMARTSM007173.2E-15107156IPR001005SANT/Myb domain
PfamPF002493.8E-15108154IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-25110159IPR009057Homeodomain-like
CDDcd001671.84E-15111154No hitNo description
PROSITE profilePS5129417.468159209IPR017930Myb domain
SMARTSM007179.9E-17159207IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-22160206IPR009057Homeodomain-like
PfamPF002491.7E-15163202IPR001005SANT/Myb domain
CDDcd001676.00E-14163205No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MAAAGNSFLN QELVKVADGV SDWHLPSSSH GGTCHTNTRG APITVGVPDL GCPVSSIGMA  60
TSSSLMPKEG LTTASYNSVV AFPVGATMVP QQQQTQAAGS NDNPGLVKGG WTREEDEVLR  120
QMVRHHGDRK WAEIAKSLPG RVGKQCRERW TNHLHPDIKK DIWTEEEDRM LIEAHQTYGN  180
SWSAIAKQLP GRSENTIKNH WNATKRSLNS KRRLRKKNSE QTVPGQPSLL ESYIRSCQHM  240
LPSETVPPPP APFDISRYGN SGVIGASPTL PVVQEPGTST PPGLVMFLDL LNQAIPHPPQ  300
PETMDLFNMT PEVSHLNTSG YCLQLDAGGN LYYGRLPAPA PVQPHGISTQ ELQDTPQLSL  360
YYPLSSFAGS HTDGTVEFNH QLSNPNGGHY GEEAGPSSVA TGGSANGMDD NDVVQMASNQ  420
FMMPSEDEGI LDLARWIN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-421042103110B-MYB
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ8GVH9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g12130.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g12130
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0051970.0AP005197.3 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0592C06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645903.10.0PREDICTED: transcription factor RAX1-like
TrEMBLQ8GVH90.0Q8GVH9_ORYSJ; Myb-like protein
STRINGLOC_Os07g12130.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.17e-47myb domain protein 98