PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g07974.1
Common NameLOC4342538, Os07g0176200, OSNPB_070176200, P0534H07.18
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CPP
Protein Properties Length: 783aa    MW: 84168.7 Da    PI: 6.4986
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g07974.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25e-16466504240
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        +k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  LOC_Os07g07974.1 466 ACKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 504
                       589**********************************96 PP

2TCR50.93.1e-16552591140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce+CkN+ 
  LOC_Os07g07974.1 552 RHKRGCNCKKSSCLKKYCECYQGGVGCSSNCRCEGCKNTF 591
                       589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-17465506IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.33466592IPR005172CRC domain
PfamPF036388.8E-12468503IPR005172CRC domain
SMARTSM011141.7E-17552593IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-12554590IPR005172CRC domain
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009037anatomylemma
PO:0001047developmental stagelemma development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MDTPDRAAAA ARAEDSPLFS FIDSLSPIEP LKSAYSASSI QAYQSLNITS ISSIFTSPHD  60
NAQKESKLSK SSFAEFSESE VCADESDKNK PSKSSNAVRL FACTSTLTQA THKITSSVSE  120
GTVGPPEGSN DLPQPGQFDS GSPDHNTTPC HGVRSDLKQG KCRKLQAFQT AKTNTSEKRK  180
CLFSTEVQLM DGCQPEKLND EILGCDWDDL ISATSGELIA YDEDHKGVQL AVSNAESCGF  240
LLSKLTGDGD ISDRTHPSSS TQTYYRELLM DEDQTENAQL VPDGEKNIST EEIQDNLYEA  300
NGSIPTGYKV ETQQQRGMRR RCLVFEAAGY SNRIVQKESV MDLSVSTCKG KSPVQNHSNP  360
GKTPSPRVLR GIGLHLNALA LTSKDKMICQ DPMSSLVPSS ATQQEAHGKM LSAGENFIHP  420
GGELLELQMD DDCSAGVFLG NDHDSSQSNS PQKKRRKSDN GDDGEACKRC SCKKSKCLKL  480
YCECFAAGVY CSEPCSCQGC LNKPIHEEIV LSTRKQIEFR NPLAFAPKVI RMSDAGQDIT  540
GEDPNNTPAS ARHKRGCNCK KSSCLKKYCE CYQGGVGCSS NCRCEGCKNT FGKRDAAVST  600
EAEEMKQGGE EAENCGKEKE NDLQKANAQS EDHPFLELVP ITPPFDVSSS LLKPPNFSSA  660
KPPRPTKARS NSSRSSSKAP GAVHSQKFSK IANSGLNEEM PDILRDDASP GNCVKTSSPN  720
GKRVSPPHNA LSVSPSRKGG RKLILKSIPS FPSLIGDASS GSSMNSSESA FNTASPLALG  780
PS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1452456KKRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.734610.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329759150.0
Expression AtlasQ6ZEZ8-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g07974.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g07974
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0658970.0AK065897.1 Oryza sativa Japonica Group cDNA clone:J013048O08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646690.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLQ6ZEZ80.0Q6ZEZ8_ORYSJ; Os07g0176200 protein
STRINGLOC_Os07g07974.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-84TESMIN/TSO1-like CXC 2