PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g06470.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 358aa    MW: 37607.9 Da    PI: 8.8906
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g06470.2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.91.8e-29197251358
         CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       p+YVNaKQ+++I++RR +Rak+e+e+++ ++srkpylheSRh+hA+rR+RgsgGrF
  LOC_Os07g06470.2 197 PIYVNAKQFNGIIRRRLARAKAEREHRV-SRSRKPYLHESRHRHAMRRARGSGGRF 251
                       9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-32193254IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.417194254IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.4E-22197219IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.5E-30197251IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860199219IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.4E-22228251IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MRSAALSFQD HGHGLQAITG RGGNGGAAAH ALPWWAGAGA GAGSQTLLGT GGGEESFCQL  60
SNTIMEDTRI LQNHHHQILA AGRQLQQRHH FPAMPPERHH HPPPPAPGSP AMKFPIISGD  120
SDLGKDLKFH ESSAPTIAAY SPLQEYQGHF ELALGHSMVC TNFCNSEQSY GVYSPYGAQT  180
MAGRMLLPPA IATDVGPIYV NAKQFNGIIR RRLARAKAER EHRVSRSRKP YLHESRHRHA  240
MRRARGSGGR FLNTKNASSA AAAAADAAPV SSGGGDHGAS NKSSSASEAT RVYDDDDDMG  300
AGGGGDGGDF HHAMGHLRSP AFFPSLAAMM DGGGGGGEGK WATATPHHGC RVDLLKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A1e-17196253361HAPB protein
4g92_A1e-17196253361HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235244RHRHAMRRAR
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g06470.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g06470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0054540.0AP005454.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0455F03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645550.10.0PREDICTED: nuclear transcription factor Y subunit A-2
TrEMBLB8B7E00.0B8B7E0_ORYSI; Putative uncharacterized protein
STRINGLOC_Os07g06470.20.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP146632123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.31e-25nuclear factor Y, subunit A10