PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g06470.1
Common NameOs07g0158500, OSNPB_070158500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NF-YA
Protein Properties Length: 294aa    MW: 31389 Da    PI: 9.3467
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g06470.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.41.3e-29133187358
         CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       p+YVNaKQ+++I++RR +Rak+e+e+++ ++srkpylheSRh+hA+rR+RgsgGrF
  LOC_Os07g06470.1 133 PIYVNAKQFNGIIRRRLARAKAEREHRV-SRSRKPYLHESRHRHAMRRARGSGGRF 187
                       9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.0E-32129190IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.417130190IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.8E-30133187IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-22133155IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860135155IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-22164187IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEDTRILQNH HHQILAAGRQ LQQRHHFPAM PPERHHHPPP PAPGSPAMKF PIISGDSDLG  60
KDLKFHESSA PTIAAYSPLQ EYQGHFELAL GHSMVCTNFC NSEQSYGVYS PYGAQTMAGR  120
MLLPPAIATD VGPIYVNAKQ FNGIIRRRLA RAKAEREHRV SRSRKPYLHE SRHRHAMRRA  180
RGSGGRFLNT KNASSAAAAA ADAAPVSSGG GDHGASNKSS SASEATRVYD DDDDMGAGGG  240
GDGGDFHHAM GHLRSPAFFP SLAAMMDGGG GGGEGKWATA TPHHGCRVDL LKV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_A7e-18133189461HAPB protein
4g92_A7e-18133189461HAPB protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1171180RHRHAMRRAR
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0N7KMY8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g06470.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g06470
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126150.0CP012615.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 7 sequence.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
GenBankAP0054540.0AP005454.4 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0455F03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645550.10.0PREDICTED: nuclear transcription factor Y subunit A-2
TrEMBLA0A0N7KMY80.0A0A0N7KMY8_ORYSJ; Os07g0158500 protein (Fragment)
TrEMBLB0S4T50.0B0S4T5_ORYSJ; HAP2 subunit of HAP complex
TrEMBLB8B7E00.0B8B7E0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA024793-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g06470.20.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.34e-26nuclear factor Y, subunit A10