PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g04700.3
Common NameLOC4342365, OJ1417_E01.122, Os07g0139500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 835aa    MW: 92424.6 Da    PI: 10.1846
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g04700.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.94.6e-08156248147
                       TSSS-HHHHHHHHHHHHHTTTT..............................................-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg..............................................tWktIartmgkgRtlkqcksrwqky 47 
                       +++W+  E e+l++++kq   +                                              +W++Ia++   gR++ +c srw+++
  LOC_Os07g04700.3 156 KQPWSDVEKEKLAKGIKQQYQEalilnsinkgsstgdfsavdmayaltntagnfevtpeslrsvlpliNWDKIAAMYLPGRSGAECESRWLNF 248
                       79****************99999***************************************************99888************97 PP

2Myb_DNA-binding29.71.5e-09256300246
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++WT+ E+++l+  v+q G+++W  Ia t+g++Rt+ qc  r+q 
  LOC_Os07g04700.3 256 NAWTAREEKRLILTVQQQGMNNWINIAVTLGTHRTPFQCLVRYQR 300
                       68**************************************99995 PP

3Myb_DNA-binding43.66.7e-14310353348
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        W +eEd++l  av+ +G++ W ++++ m  gRt++qc +rw+k l
  LOC_Os07g04700.3 310 DWAEEEDLQLQAAVNTFGTN-WQLVSASMD-GRTGNQCSNRWRKTL 353
                       6*****************99.*********.************975 PP

4Myb_DNA-binding51.32.7e-16361406248
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       grW+ +Ed++l  avk++G+g+W++Ia+ ++ gRt  qc +rw+++l
  LOC_Os07g04700.3 361 GRWSLDEDKRLMVAVKLFGSGSWNKIAQFIP-GRTQSQCNERWRNVL 406
                       8******************************.************986 PP

5Myb_DNA-binding31.73.6e-10413457247
                       SSS-HHHHHHHHHHHHHTTTT-HHHHH.HHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIa.rtmgkgRtlkqcksrwqky 47 
                       g W +eEd +l+  v ++G+  W++Ia ++++ +Rt+++c  rw+k+
  LOC_Os07g04700.3 413 GEWRPEEDSILLASVDEFGPC-WSKIAgAKIP-HRTDNMCLRRWRKL 457
                       68*****************88.****945777.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.377151249IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.1E-7152174IPR009057Homeodomain-like
SMARTSM007179.8E-6155251IPR001005SANT/Myb domain
CDDcd001670.00116220248No hitNo description
Gene3DG3DSA:1.10.10.603.1E-7221235IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-7236269IPR009057Homeodomain-like
PROSITE profilePS500908.502250302IPR017877Myb-like domain
SMARTSM007170.0017254304IPR001005SANT/Myb domain
SuperFamilySSF466892.04E-21255349IPR009057Homeodomain-like
PfamPF002495.9E-6256300IPR001005SANT/Myb domain
CDDcd001671.32E-4257302No hitNo description
Gene3DG3DSA:1.10.10.603.4E-11270314IPR009057Homeodomain-like
PROSITE profilePS5129410.432303353IPR017930Myb domain
SMARTSM007171.2E-11307355IPR001005SANT/Myb domain
PfamPF002493.1E-12310352IPR001005SANT/Myb domain
CDDcd001672.75E-9311353No hitNo description
Gene3DG3DSA:1.10.10.602.2E-14315356IPR009057Homeodomain-like
PROSITE profilePS5129419.971354410IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-18358406IPR009057Homeodomain-like
SuperFamilySSF466894.93E-26359454IPR009057Homeodomain-like
SMARTSM007173.0E-12359408IPR001005SANT/Myb domain
PfamPF002492.4E-15361406IPR001005SANT/Myb domain
CDDcd001671.83E-11362406No hitNo description
Gene3DG3DSA:1.10.10.603.2E-15407462IPR009057Homeodomain-like
SMARTSM007171.9E-8411460IPR001005SANT/Myb domain
PfamPF002492.7E-8413457IPR001005SANT/Myb domain
PROSITE profilePS5129413.267413462IPR017930Myb domain
CDDcd001677.30E-9414457No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020048anatomymicrospore
PO:0001009developmental stageD pollen mother cell meiosis stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 835 aa     Download sequence    Send to blast
MNTKTEASKE GSGNIFGNEL DEEFDAEKHN KEATTRTGFP KAALLLVDAL KKNRACQKFI  60
RRKMITIEAK IEENKDLRDR VKCLLDYQLS CRKAFGKILC QKEDPRVRLI SSRKPCAQST  120
KNKDKKTPAL FLGPADNPHV SKYKMVLKQL PMSLQKQPWS DVEKEKLAKG IKQQYQEALI  180
LNSINKGSST GDFSAVDMAY ALTNTAGNFE VTPESLRSVL PLINWDKIAA MYLPGRSGAE  240
CESRWLNFDD PLISHNAWTA REEKRLILTV QQQGMNNWIN IAVTLGTHRT PFQCLVRYQR  300
SLNHCILNKD WAEEEDLQLQ AAVNTFGTNW QLVSASMDGR TGNQCSNRWR KTLNPERSRV  360
GRWSLDEDKR LMVAVKLFGS GSWNKIAQFI PGRTQSQCNE RWRNVLDPDI DLGEWRPEED  420
SILLASVDEF GPCWSKIAGA KIPHRTDNMC LRRWRKLCQD KLPSVKAAQQ IKKSILQCNF  480
VDRETERPAI GPSDLMPLVR SKVDGSDENT VSAKVRKPRK RSRIPCEDNV LPGDTSNSSP  540
SMNLPLSESI DAEAAVNTTT ANSKKKPSRS RSKKQTDENL AVCDVNNSSN CSSGARKRKR  600
SITDKNQVVQ KKMKGSISGD NEAVVETVGT ISADNEVATK RKTGSTSVGE EGTTKKTTRG  660
SLSGKGEVNK RMRGSISGVQ KGATKQRMRG SVSTDNHGAV MKSKRAPSRK SAEENSKADS  720
MANAAFGSDL PTVASEDRDA NNGNVKNGRL KSMPRPKQIN MTEGSADKFS TSTRLADCMS  780
FGRINGSSRV ARHLCVSVKP LSNMIQSNGP SDVSAKDPTS AETDPTSVEN SNTA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-262274548155MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-262274548155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.492020.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329754700.0
Expression AtlasQ7XIP8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g04700.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g04700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0654520.0AK065452.1 Oryza sativa Japonica Group cDNA clone:J013025M19, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647438.10.0PREDICTED: uncharacterized protein LOC4342365 isoform X2
RefseqXP_015647439.10.0PREDICTED: uncharacterized protein LOC4342365 isoform X2
RefseqXP_015647441.10.0PREDICTED: uncharacterized protein LOC4342365 isoform X2
TrEMBLQ7XIP80.0Q7XIP8_ORYSJ; Basal transcription factor SNAPc large chain SNAP190-like protein
STRINGBGIOSGA024846-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g04700.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-145myb domain protein 4r1