PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g03770.1
Common NameHOS3, LOC4342320, Os07g0129700, OSH15, OSJNBa0088O14.22, P0483E09.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 356aa    MW: 38590.4 Da    PI: 7.0002
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g03770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox309e-102813162055
                       HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
          Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  LOC_Os07g03770.1 281 YKWPYPSETEKIALAESTGLDQKQINNWFINQRKRH 316
                       4679*****************************885 PP

2ELK35.71.8e-12236257122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELK qLl+KYsgyL+sL+qEFs
  LOC_Os07g03770.1 236 ELKFQLLKKYSGYLSSLRQEFS 257
                       9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.8E-2389133IPR005540KNOX1
PfamPF037904.0E-2291131IPR005540KNOX1
SMARTSM012565.4E-30136187IPR005541KNOX2
PfamPF037917.8E-24141185IPR005541KNOX2
PROSITE profilePS5121311.401236256IPR005539ELK domain
SMARTSM011885.7E-7236257IPR005539ELK domain
PfamPF037892.2E-9236257IPR005539ELK domain
PROSITE profilePS5007112.892256319IPR001356Homeobox domain
SuperFamilySSF466891.24E-19257330IPR009057Homeodomain-like
SMARTSM003894.4E-13258323IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.8E-28261320IPR009057Homeodomain-like
CDDcd000863.73E-12268320No hitNo description
PfamPF059209.9E-17276315IPR008422Homeobox KN domain
PROSITE patternPS000270294317IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MDQSFGNLGG GGGAGGSGKA AASSFLQLPL STAAAATAYY GTPLALHQAA AAAGPSQYHG  60
HGHPHHGGGH HHSKHGGAGG GEISAAEAES IKAKIMAHPQ YSALLAAYLD CQKVGAPPEV  120
LERLTATAAK LDARPPGRHD ARDPELDQFM EAYCNMLAKY REELTRPIDE AMEFLKRVES  180
QLDTIAGGAH GGGAGSARLL LADGKSECVG SSEDDMDPSG RENEPPEIDP RAEDKELKFQ  240
LLKKYSGYLS SLRQEFSKKK KKGKLPKEAR QKLLHWWELH YKWPYPSETE KIALAESTGL  300
DQKQINNWFI NQRKRHWKPS EDMPFVMMEG FHPQNAAALY MDGPFMADGM YRLGS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.22540.0callus| panicle| root| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1567647870.0
Expression AtlasO80416-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the embryo at 4 days after pollination (DAP) in the ventral and basal part of the embryo, including the initial of the shoot apical meristem (SAM). At 5 DAP, expressed at the ventral side of the embryo, but the expression within SAM is down-regulated. At 7 DAP, expression is restricted to the boundaries between the embryonic organs, between the scutellum and the coleoptile, the coleoptile and the second leaf primordium, the shoot apical meristem and the first leaf primordium, the first leaf primordium and the coleoptile, the coleoptile and the epiblast and at the tip of the epiblast, but not in the leaf primordia. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:10095070, ECO:0000269|PubMed:9869405}.
UniprotTISSUE SPECIFICITY: Expressed in stems, rachis and inflorescence. {ECO:0000269|PubMed:9869405}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269|PubMed:10080693, ECO:0000269|PubMed:9869405}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g03770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch O80416
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g03770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402080.0FJ940208.1 Oryza sativa Japonica Group clone KCB937E04 homeobox protein mRNA, complete cds.
GenBankAB0160710.0AB016071.1 Oryza sativa Japonica Group mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646117.10.0PREDICTED: homeobox protein knotted-1-like 12
SwissprotO650340.0KNOSC_ORYSI; Homeobox protein knotted-1-like 12
SwissprotO804160.0KNOSC_ORYSJ; Homeobox protein knotted-1-like 12
TrEMBLB8B7560.0B8B756_ORYSI; Putative uncharacterized protein
TrEMBLB9FVB70.0B9FVB7_ORYSJ; Homeobox protein
STRINGBGIOSGA025091-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g03770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-101KNOTTED-like from Arabidopsis thaliana
Publications ? help Back to Top
  1. Postma-Haarsma AD, et al.
    Characterization of the KNOX class homeobox genes Oskn2 and Oskn3 identified in a collection of cDNA libraries covering the early stages of rice embryogenesis.
    Plant Mol. Biol., 1999. 39(2): p. 257-71
    [PMID:10080693]
  2. Ito Y,Eiguchi M,Kurata N
    Expression of novel homeobox genes in early embryogenesis in rice.
    Biochim. Biophys. Acta, 1999. 1444(3): p. 445-50
    [PMID:10095070]
  3. Nagasaki H,Matsuoka M,Sato Y
    Members of TALE and WUS subfamilies of homeodomain proteins with potentially important functions in development form dimers within each subfamily in rice.
    Genes Genet. Syst., 2005. 80(4): p. 261-7
    [PMID:16284419]
  4. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]
  5. Sato Y,Sentoku N,Nagato Y,Matsuoka M
    Isolation and characterization of a rice homebox gene, OSH15.
    Plant Mol. Biol., 1998. 38(6): p. 983-98
    [PMID:9869405]