PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g02800.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 400aa    MW: 43138 Da    PI: 7.4448
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g02800.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like902.1e-28228279152
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                       k+r++W+p+LH++Fv a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQ 
  LOC_Os07g02800.3 228 KTRRCWSPDLHRKFVAALQQLGGPQVATPKQIRELMKVDGLTNDEVKSHLQV 279
                       68*************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.263225285IPR017930Myb domain
SuperFamilySSF466894.3E-13226280IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-24226281IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-23228280IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGLDVGEIGV GAADLSLDLK MFAAKSFGRV RGKDTTTTAM GDCIRRLEEE MGKIEVFRRE  60
LPLCVRLLAD VIDVMKEEVE KKGGDRKEDE EDAAGDKSNW MSTAQLWTGN SGGPDAAAAD  120
PEKQDKVRIS SEAKSNGGAF VGSGAPAFAR PKQSLMRKED MAYDVRMPDL SLLSPPASAA  180
AADESRRQVV GFSQAAARAA AMAASGPALS LQPQPQPAAA QQQQQARKTR RCWSPDLHRK  240
FVAALQQLGG PQVATPKQIR ELMKVDGLTN DEVKSHLQVR KIHHCFFCLP QDFLHQCSVT  300
IMTSRDGFAM ILMSIFAILI AQKYRLHNRP RVPSSTIVNQ PIVLMQGLCY IPQEQSSSQS  360
GSPEGPLHFS GSGMAGGGSS AATVSCEEED GRSESYGWK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.103330.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329804450.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g02800.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g02800
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0704210.0AK070421.1 Oryza sativa Japonica Group cDNA clone:J023048M12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644652.10.0PREDICTED: uncharacterized protein LOC4342269
TrEMBLQ7XIF10.0Q7XIF1_ORYSJ; Os07g0119300 protein
STRINGLOC_Os07g02800.30.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP25631133
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-26G2-like family protein