PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g02060.1
Common NameLOC4342232, OJ1123_C12.118, Os07g0111400, OSNPB_070111400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family WRKY
Protein Properties Length: 291aa    MW: 30418.1 Da    PI: 6.5049
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g02060.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.71.2e-33124181259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +Dgy+WrKYGqK vk+s+fprsYYrCt ++C+vkk+vers++dp+vv++tYeg+H h+
  LOC_Os07g02060.1 124 EDGYRWRKYGQKAVKNSPFPRSYYRCTNSKCTVKKRVERSSDDPSVVITTYEGQHSHH 181
                       8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.6E-34108182IPR003657WRKY domain
SuperFamilySSF1182907.32E-29115181IPR003657WRKY domain
PROSITE profilePS5081130.079118183IPR003657WRKY domain
SMARTSM007743.4E-39123182IPR003657WRKY domain
PfamPF031065.8E-27124181IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MAMAGAGDWP FAADEAYADS SAIFAELGWA NGLAVVDAVG ELLPPLDPPG ELATPPPPPL  60
DLPETPAGSS ADGAASSCST DDADGGKPAA ASTEAASKSL TPGKKRARQP RFAFMTKSEI  120
DHLEDGYRWR KYGQKAVKNS PFPRSYYRCT NSKCTVKKRV ERSSDDPSVV ITTYEGQHSH  180
HTVTFPRAAA TAAGFSHIHA MAALAAAPFS AHQQLYSNLQ PPPPTMPLAA TTPASSSSLL  240
QLPLHCNHEL QVVASCGGYP SSSSSPPASV LPVDKGLLDD MVPRAMRHDG *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-27113180774Probable WRKY transcription factor 4
2lex_A9e-27113180774Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.389850.0callus| leaf
Os.424900.0callus| flower| leaf| panicle| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO335192030.0
Expression AtlasQ8H5U1-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00067PBMTransfer from AT1G69310Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g02060.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g02060
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3418580.0AY341858.1 Oryza sativa (japonica cultivar-group) WRKY18 mRNA, complete cds.
GenBankAK2409580.0AK240958.1 Oryza sativa Japonica Group cDNA, clone: J065045F23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645717.10.0PREDICTED: probable WRKY transcription factor 57
TrEMBLQ8H5U10.0Q8H5U1_ORYSJ; Os07g0111400 protein
STRINGLOC_Os07g02060.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1417875
MonocotsOGMP21253796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69310.23e-53WRKY DNA-binding protein 57