PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g01820.6
Common NameLOC4342214, MADS15, OJ1567_G09.109-1, Os07g0108900, P0585H11.124-1, RAP1A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 111aa    MW: 12852.9 Da    PI: 10.0492
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g01820.6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.37.4e-32959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gklyey++
  LOC_Os07g01820.6  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYAT 59
                      79***********************************************86 PP

2K-box17.41.8e-0777109335
             K-box   3 kssgksleeakaeslqqelakLkkeienLqreq 35 
                       ++   s+e++ + ++++e++kLk++ie++q+ +
  LOC_Os07g01820.6  77 EKALISAESESEGNWCHEYRKLKAKIETIQKCH 109
                       5556677888899*****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-36289IPR002100Transcription factor, MADS-box
CDDcd002652.72E-41276No hitNo description
PRINTSPR004042.9E-32323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP KGKLYEYATD  60
SRMDKILERY ERYSYAEKAL ISAESESEGN WCHEYRKLKA KIETIQKCHK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P5e-23174173Myocyte-specific enhancer factor 2B
1tqe_Q5e-23174173Myocyte-specific enhancer factor 2B
1tqe_R5e-23174173Myocyte-specific enhancer factor 2B
1tqe_S5e-23174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.127501e-148flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329827061e-148
Expression AtlasQ6Q9I2-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the floral meristem at very early stage of the spikelet (rice flower) development. Expressed in lemmas, paleas and lodicules from early to late stage of flower development. {ECO:0000269|PubMed:10945340}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g01820.6
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6Q9I2
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g01820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0586980.0AF058698.1 Oryza sativa MADS15 protein mRNA, complete cds.
GenBankFJ7509430.0FJ750943.1 Oryza sativa clone KCS304B02 MADS-box transcription factor 15 mRNA, complete cds.
GenBankAY5519200.0AY551920.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS215 mRNA, complete cds.
GenBankAB0033250.0AB003325.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31864.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006657400.11e-76PREDICTED: MADS-box transcription factor 15
RefseqXP_015645258.11e-76PREDICTED: MADS-box transcription factor 15 isoform X1
RefseqXP_015645259.11e-76PREDICTED: MADS-box transcription factor 15 isoform X2
SwissprotQ6Q9I22e-78MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLD3U2H51e-76D3U2H5_ORYSA; MADS-box transcription factor 15
TrEMBLJ3MI311e-76J3MI31_ORYBR; Uncharacterized protein
STRINGOB07G10630.13e-76(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.11e-55MIKC_MADS family protein
Publications ? help Back to Top
  1. Shinozuka Y, et al.
    Isolation and characterization of rice MADS box gene homologues and their RFLP mapping.
    DNA Res., 1999. 6(2): p. 123-9
    [PMID:10382970]
  2. Moon YH, et al.
    Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
    Plant Physiol., 1999. 120(4): p. 1193-204
    [PMID:10444103]
  3. Kyozuka J,Kobayashi T,Morita M,Shimamoto K
    Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes.
    Plant Cell Physiol., 2000. 41(6): p. 710-8
    [PMID:10945340]
  4. Lim J,Moon YH,An G,Jang SK
    Two rice MADS domain proteins interact with OsMADS1.
    Plant Mol. Biol., 2000. 44(4): p. 513-27
    [PMID:11197326]
  5. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  6. Ren D, et al.
    MULTI-FLORET SPIKELET1, which encodes an AP2/ERF protein, determines spikelet meristem fate and sterile lemma identity in rice.
    Plant Physiol., 2013. 162(2): p. 872-84
    [PMID:23629832]