PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g01820.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 26734.4 Da    PI: 8.2146
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g01820.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.13.5e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gklyey++
  LOC_Os07g01820.4  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYAT 59
                      79***********************************************86 PP

2K-box105.18.4e-3578172498
             K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       +   s+e++ + ++++e++kLk++ie++q+ ++hl+GedLesL+lkeLqqLeqqLe+slk+i s+K++l+le+i+elqkke++lqeenkaL+k
  LOC_Os07g01820.4  78 KALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQK 170
                       556667888899********************************************************************************9 PP

             K-box  97 kl 98 
                       + 
  LOC_Os07g01820.4 171 EC 172
                       86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-35289IPR002100Transcription factor, MADS-box
CDDcd002655.66E-41276No hitNo description
PRINTSPR004041.5E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-313859IPR002100Transcription factor, MADS-box
PfamPF014862.1E-2984172IPR002487Transcription factor, K-box
PROSITE profilePS5129716.59888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP KGKLYEYATD  60
SRMDKILERY ERYSYAEKAL ISAESESEGN WCHEYRKLKA KIETIQKCHK HLMGEDLESL  120
NLKELQQLEQ QLESSLKHII SRKSHLMLES ISELQKKERS LQEENKALQK ECAHAAGGEA  180
EECEGPAASR AVGPNPGPGP GPSPTPSPDK LLLLLHAEGS AGTSSTTKYL LPAGDDGREK  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q3e-22174173Myocyte-specific enhancer factor 2B
1tqe_R3e-22174173Myocyte-specific enhancer factor 2B
1tqe_S3e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.127500.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329827060.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g01820.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g01820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519200.0AY551920.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS215 mRNA, complete cds.
GenBankAB0033250.0AB003325.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31864.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645261.11e-176PREDICTED: MADS-box transcription factor 15 isoform X3
SwissprotQ6Q9I21e-121MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLD3U2H51e-119D3U2H5_ORYSA; MADS-box transcription factor 15
STRINGOB07G10630.11e-117(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.19e-71MIKC_MADS family protein