PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g01820.3
Common NameLOC4342214, MADS15, OJ1567_G09.109-1, Os07g0108900, P0585H11.124-1, RAP1A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 268aa    MW: 30390.7 Da    PI: 9.4939
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g01820.3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.94.2e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gklyey++
  LOC_Os07g01820.3  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYAT 59
                      79***********************************************86 PP

2K-box104.21.6e-3478173499
             K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                       +   s+e++ + ++++e++kLk++ie++q+ ++hl+GedLesL+lkeLqqLeqqLe+slk+i s+K++l+le+i+elqkke++lqeenkaL+k
  LOC_Os07g01820.3  78 KALISAESESEGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQK 170
                       556667888899********************************************************************************9 PP

             K-box  97 kle 99 
                       +l 
  LOC_Os07g01820.3 171 ELV 173
                       986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.5E-35288IPR002100Transcription factor, MADS-box
CDDcd002654.40E-42276No hitNo description
PRINTSPR004041.9E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-313859IPR002100Transcription factor, MADS-box
PfamPF014868.3E-2984172IPR002487Transcription factor, K-box
PROSITE profilePS5129717.12988178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP KGKLYEYATD  60
SRMDKILERY ERYSYAEKAL ISAESESEGN WCHEYRKLKA KIETIQKCHK HLMGEDLESL  120
NLKELQQLEQ QLESSLKHII SRKSHLMLES ISELQKKERS LQEENKALQK ELVERQKNVR  180
GQQQVGQWDQ TQVQAQAQAQ PQAQTSSSSS SMLRDQQALL PPQNICYPPV MMGERNDAAA  240
AAAVAAQGQV QLRIGGLPPW MLSHLNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-22174173Myocyte-specific enhancer factor 2B
1tqe_Q7e-22174173Myocyte-specific enhancer factor 2B
1tqe_R7e-22174173Myocyte-specific enhancer factor 2B
1tqe_S7e-22174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.127500.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329827060.0
Expression AtlasQ6Q9I2-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the floral meristem at very early stage of the spikelet (rice flower) development. Expressed in lemmas, paleas and lodicules from early to late stage of flower development. {ECO:0000269|PubMed:10945340}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g01820.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6Q9I2
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g01820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519200.0AY551920.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS215 mRNA, complete cds.
GenBankAB0033250.0AB003325.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31864.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645259.10.0PREDICTED: MADS-box transcription factor 15 isoform X2
SwissprotQ6Q9I20.0MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLA0A0E0E6U80.0A0A0E0E6U8_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0Q3850.0A0A0E0Q385_ORYRU; Uncharacterized protein
STRINGBGIOSGA024961-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os07g01820.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.14e-72MIKC_MADS family protein
Publications ? help Back to Top
  1. Shinozuka Y, et al.
    Isolation and characterization of rice MADS box gene homologues and their RFLP mapping.
    DNA Res., 1999. 6(2): p. 123-9
    [PMID:10382970]
  2. Moon YH, et al.
    Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system.
    Plant Physiol., 1999. 120(4): p. 1193-204
    [PMID:10444103]
  3. Kyozuka J,Kobayashi T,Morita M,Shimamoto K
    Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes.
    Plant Cell Physiol., 2000. 41(6): p. 710-8
    [PMID:10945340]
  4. Lim J,Moon YH,An G,Jang SK
    Two rice MADS domain proteins interact with OsMADS1.
    Plant Mol. Biol., 2000. 44(4): p. 513-27
    [PMID:11197326]
  5. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  6. Ren D, et al.
    MULTI-FLORET SPIKELET1, which encodes an AP2/ERF protein, determines spikelet meristem fate and sterile lemma identity in rice.
    Plant Physiol., 2013. 162(2): p. 872-84
    [PMID:23629832]