PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os07g01820.1
Common NameOsJ_22820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 297aa    MW: 33591.5 Da    PI: 9.3479
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os07g01820.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.74.9e-31959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gklyey++
  LOC_Os07g01820.1  9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPKGKLYEYAT 59
                      79***********************************************86 PP

2K-box101.98.8e-341152021299
             K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                       ++  ++++e++kLk++ie++q+ ++hl+GedLesL+lkeLqqLeqqLe+slk+i s+K++l+le+i+elqkke++lqeenkaL+k+l 
  LOC_Os07g01820.1 115 KTLGNWCHEYRKLKAKIETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERSLQEENKALQKELV 202
                       56789*******************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-34287IPR002100Transcription factor, MADS-box
CDDcd002653.90E-42276No hitNo description
PRINTSPR004042.4E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-313859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129717.123117207IPR002487Transcription factor, K-box
PfamPF014862.9E-28118201IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP KGKLYEYATD  60
SRMDKILERY ERYSYAEKAL ISAESESEIT LPQLTTCTAS RSTHGICFQY CLMSKTLGNW  120
CHEYRKLKAK IETIQKCHKH LMGEDLESLN LKELQQLEQQ LESSLKHIIS RKSHLMLESI  180
SELQKKERSL QEENKALQKE LVERQKNVRG QQQVGQWDQT QVQAQAQAQP QAQTSSSSSS  240
MLRDQQALLP PQNICYPPVM MGERNDAAAA AAVAAQGQVQ LRIGGLPPWM LSHLNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-21174173Myocyte-specific enhancer factor 2B
1tqe_Q2e-21174173Myocyte-specific enhancer factor 2B
1tqe_R2e-21174173Myocyte-specific enhancer factor 2B
1tqe_S2e-21174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.127500.0flower| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329827060.0
Expression AtlasB9FV55-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os07g01820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs07g01820
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5519200.0AY551920.1 Oryza sativa (japonica cultivar-group) MADS-box protein RMADS215 mRNA, complete cds.
GenBankAB0033250.0AB003325.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E31864.
GenBankAK0726830.0AK072683.1 Oryza sativa Japonica Group cDNA clone:J023140K24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645259.10.0PREDICTED: MADS-box transcription factor 15 isoform X2
SwissprotQ6Q9I20.0MAD15_ORYSJ; MADS-box transcription factor 15
TrEMBLB8B6K90.0B8B6K9_ORYSI; Putative uncharacterized protein
TrEMBLB9FV550.0B9FV55_ORYSJ; Uncharacterized protein
STRINGLOC_Os07g01820.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA024961-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP115137113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69120.14e-66MIKC_MADS family protein