PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g51260.1
Common NameLOC4342135, Os06g0728700, OsJ_22733, OSJNBa0069C14.1, OSNPB_060728700, P0017G10.36
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 452aa    MW: 49486.6 Da    PI: 4.9832
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g51260.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.21.4e-1665109147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r +WT+eE++++++a k++G   W+ I +++g ++t+ q++s+ qk+
  LOC_Os06g51260.1  65 REKWTEEEHDKFLEALKLYGRS-WRQIQEHIG-TKTAVQIRSHAQKF 109
                       789*****************55.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-1659113IPR009057Homeodomain-like
PROSITE profilePS5129421.58560114IPR017930Myb domain
TIGRFAMsTIGR015574.3E-1663112IPR006447Myb domain, plants
SMARTSM007172.9E-1464112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-1065105IPR009057Homeodomain-like
PfamPF002491.7E-1465108IPR001005SANT/Myb domain
CDDcd001673.45E-1167110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009845Biological Processseed germination
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 452 aa     Download sequence    Send to blast
MASMPQLEEK DSSDLAINKG PSLDLVKSPL MMNDASATVT AMQPNEGMEE FPVKVRKPYT  60
ITKQREKWTE EEHDKFLEAL KLYGRSWRQI QEHIGTKTAV QIRSHAQKFF SKVVREPGSN  120
NAIEIPPPRP KRKPLHPYPR KCANSGSDAN PATAQLKLAP GSSSSGSDQE NGSPISVLSA  180
MQSDAFGSSV SNPSTRCTSP ASSDDGNNIP TFTSGEDNNV PCEPTVIDPS QSHKEIDQDR  240
KDVNNMSEED SSEEEVQETS LKLFGRTVVI PDPRKRSSSD PKHESEEQIS QPSNEEMLQA  300
SSSVGEIPAA YCAPNGWFMS YNSFPFQFGE SAADARIPPL HVWWPYYGFA PISHPRGLST  360
VMQQTEGSDE SDGVKSHSSE SSSDSGENVQ MTAPQSSRIV ESLGAIYVRD SGSSFELKPS  420
ANSAFVRVKP SNSGDEEVIR GFVPYKRCKF Q*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.189550.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1943960960.0
Expression AtlasQ5Z5B9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g51260.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g51260
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1196320.0AK119632.1 Oryza sativa Japonica Group cDNA clone:002-130-E11, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644385.10.0PREDICTED: protein REVEILLE 1 isoform X1
TrEMBLA0A0E0Q2W80.0A0A0E0Q2W8_ORYRU; Uncharacterized protein
TrEMBLQ5Z5B90.0Q5Z5B9_ORYSJ; Os06g0728700 protein
STRINGLOC_Os06g51260.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12551549
MonocotsOGMP77833647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G37260.12e-38MYB_related family protein