PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g50830.1
Common NameOs06g0719500, OSNPB_060719500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 168aa    MW: 18258.6 Da    PI: 8.7084
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g50830.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_157.82.4e-1895152360
                       XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                       +++r++r+++NRe+A rsR+RK+a++eeLe++v  L   N  Lkk+ +elk+eva+l 
  LOC_Os06g50830.1  95 DDRRTIRMMRNRESALRSRARKRAYVEELEKEVRRLVDDNLNLKKQCKELKQEVAALV 152
                       589***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.6E-1693151No hitNo description
SMARTSM003384.6E-1593157IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.78395151IPR004827Basic-leucine zipper domain
PfamPF001702.4E-1596152IPR004827Basic-leucine zipper domain
CDDcd147071.24E-1897151No hitNo description
SuperFamilySSF579594.11E-1397151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MANYHHQEYY QMAAAAAVAW PREPDSPQLS IMSGCSSLFS ISTLRDDDDG GGVRLAGAAL  60
PATPVSLAGI AGGASTPGGD EVDMEVRQQS GGSGDDRRTI RMMRNRESAL RSRARKRAYV  120
EELEKEVRRL VDDNLNLKKQ CKELKQEVAA LVMPTKSSLR RTSSTQF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.559150.0callus| flower| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasA0A0P0X1A0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g50830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g50830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2431440.0AK243144.1 Oryza sativa Japonica Group cDNA, clone: J100032B03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643107.11e-121PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643106.11e-121PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643094.11e-121PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643093.11e-121PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643092.11e-121PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015642449.11e-121PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0P0X1A01e-121A0A0P0X1A0_ORYSJ; Os06g0719500 protein (Fragment)
STRINGLOC_Os06g50830.11e-120(Oryza sativa Japonica Group)
STRINGLOC_Os06g50600.11e-120(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9528513
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.13e-11bZIP family protein