PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g50310.1
Common NameLOC4342078, Os06g0716800, OsJ_22672, OSNPB_060716800, P0481E08.37, P0541C02.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 273aa    MW: 29217.8 Da    PI: 6.2206
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g50310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.71.2e-0898142852
                       HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                       +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++ 
  LOC_Os06g50310.1  98 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNH 142
                       55566**********************************999975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.3E-1389159No hitNo description
SMARTSM003382.8E-889158IPR004827Basic-leucine zipper domain
PfamPF077167.6E-1593148IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.24E-795142No hitNo description
CDDcd146865.14E-12103150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MDDGDLDFSN PDTFLCPAVG GADPDGSCSM DSYFDDILKD TEHHACTHTH TCNPPVHDLS  60
HTHTCVHVHT KIVSAPSDTP SDAAETAESP TENNASKKRP SGNRAAVRKY REKKKAHTAS  120
LEEEVVHLRA LNQQLMKKLQ NHATLEAEVS RLRCLLVDIR GRIEGEIGAF PYQRPVKNID  180
LVSSVDQGSY LGGAQVMNSC DFRCADQMYC SPGMQVRTMG EDGAVSGQVL GQGACDIASI  240
QCQGAKSGSA KLPVCGAMGT MPVGCMPNSE KK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.53990.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329816620.0
Expression AtlasQ5Z8P6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g50310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g50310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0917740.0AC091774.7 Oryza sativa chromosome 6 BAC OJ1540_H01 genomic sequence, complete sequence.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0037690.0AP003769.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0541C02.
GenBankAP0036140.0AP003614.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0481E08.
GenBankAK1039680.0AK103968.1 Oryza sativa Japonica Group cDNA clone:001-016-A09, full insert sequence.
GenBankAK0716390.0AK071639.1 Oryza sativa Japonica Group cDNA clone:J023099K10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642506.10.0PREDICTED: uncharacterized protein LOC4342078
RefseqXP_015642505.10.0PREDICTED: uncharacterized protein LOC4342078
SwissprotQ8VY762e-76BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0D3GKV60.0A0A0D3GKV6_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0AEE30.0A0A0E0AEE3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0HVF40.0A0A0E0HVF4_ORYNI; Uncharacterized protein
TrEMBLA0A0E0Q2P70.0A0A0E0Q2P7_ORYRU; Uncharacterized protein
TrEMBLA2YH090.0A2YH09_ORYSI; Putative uncharacterized protein
TrEMBLI1Q5B20.0I1Q5B2_ORYGL; Uncharacterized protein
TrEMBLQ5Z8P60.0Q5Z8P6_ORYSJ; Os06g0716800 protein
STRINGLOC_Os06g50310.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA020526-PA0.0(Oryza sativa Indica Group)
STRINGORGLA06G0232500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19701536
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.15e-68bZIP family protein