PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g49840.1
Common NameLOC4342047, MADS16, OJ1663_H12.32, Os06g0712700, P0712G01.7, SPW1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MIKC_MADS
Protein Properties Length: 225aa    MW: 25463.8 Da    PI: 8.6281
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g49840.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.58.2e-29959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      krien +nrqvt+skRr+gi+KKA EL vLCda+va+i+fsstgk +e++s
  LOC_Os06g49840.1  9 KRIENATNRQVTYSKRRTGIMKKARELTVLCDAQVAIIMFSSTGKYHEFCS 59
                      79***********************************************96 PP

2K-box86.55.3e-2971168198
             K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93 
                       yq++ g+sl+ +++e++q+ l+ Lk+ ++nL++e+R+++GedL+ L++ eL+ Leq+++ +lk++R +K++++++q+e+ +kk k   e+ ++
  LOC_Os06g49840.1  71 YQQAIGTSLWIEQYENMQRTLSHLKDINRNLRTEIRQRMGEDLDGLEFDELRGLEQNVDAALKEVRHRKYHVITTQTETYKKKVKHSYEAYET 163
                       67888999************************************************************************************* PP

             K-box  94 Lrkkl 98 
                       L+++l
  LOC_Os06g49840.1 164 LQQEL 168
                       *9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.6E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.674161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.72E-37295IPR002100Transcription factor, MADS-box
CDDcd002654.07E-43280No hitNo description
PRINTSPR004042.3E-28323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.8E-2182168IPR002487Transcription factor, K-box
PROSITE profilePS5129714.93684174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010097Biological Processspecification of stamen identity
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MGRGKIEIKR IENATNRQVT YSKRRTGIMK KARELTVLCD AQVAIIMFSS TGKYHEFCSP  60
STDIKGIFDR YQQAIGTSLW IEQYENMQRT LSHLKDINRN LRTEIRQRMG EDLDGLEFDE  120
LRGLEQNVDA ALKEVRHRKY HVITTQTETY KKKVKHSYEA YETLQQELGL REEPAFGFVD  180
NTGGGWDGGA GAGAAADMFA FRVVPSQPNL HGMAYGGNHD LRLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A9e-17273170MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-16273170Myocyte-specific enhancer factor 2A
3p57_I1e-16273170Myocyte-specific enhancer factor 2A
3p57_D1e-16273170Myocyte-specific enhancer factor 2A
3p57_C1e-16273170Myocyte-specific enhancer factor 2A
3p57_B1e-16273170Myocyte-specific enhancer factor 2A
3p57_A1e-16273170Myocyte-specific enhancer factor 2A
3kov_J1e-16273170Myocyte-specific enhancer factor 2A
3kov_I1e-16273170Myocyte-specific enhancer factor 2A
3kov_B1e-16273170Myocyte-specific enhancer factor 2A
3kov_A1e-16273170Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.41720.0callus| flower| leaf| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329793410.0
Expression AtlasQ944S9-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269|PubMed:10394955, ECO:0000269|PubMed:12506001, ECO:0000269|PubMed:12905025, ECO:0000269|PubMed:14558657}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS4. {ECO:0000269|PubMed:12506001, ECO:0000269|PubMed:12905025, ECO:0000269|PubMed:14558657}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g49840.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Interaction ? help Back to Top
Source Intact With
IntActSearch Q944S9
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g49840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0033230.0AB003323.1 Oryza sativa Japonica Group mRNA for MADS box-like protein, complete cds, clone:E20969.
GenBankAK2892480.0AK289248.1 Oryza sativa Japonica Group cDNA, clone: J100079D02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641661.11e-169PREDICTED: MADS-box transcription factor 16
SwissprotQ944S91e-171MAD16_ORYSJ; MADS-box transcription factor 16
TrEMBLB9A8551e-168B9A855_9ORYZ; MADS-box protein
TrEMBLB9A8571e-168B9A857_9ORYZ; MADS-box protein
TrEMBLB9A8B81e-168B9A8B8_ORYRU; MADS-box protein
STRINGLOC_Os06g49840.11e-168(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP51991121
MonocotsOGMP57283552
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.15e-63MIKC_MADS family protein
Publications ? help Back to Top
  1. Shinozuka Y, et al.
    Isolation and characterization of rice MADS box gene homologues and their RFLP mapping.
    DNA Res., 1999. 6(2): p. 123-9
    [PMID:10382970]
  2. Moon YH,Jung JY,Kang HG,An G
    Identification of a rice APETALA3 homologue by yeast two-hybrid screening.
    Plant Mol. Biol., 1999. 40(1): p. 167-77
    [PMID:10394955]
  3. Nagasawa N, et al.
    SUPERWOMAN1 and DROOPING LEAF genes control floral organ identity in rice.
    Development, 2003. 130(4): p. 705-18
    [PMID:12506001]
  4. Cooper B, et al.
    A network of rice genes associated with stress response and seed development.
    Proc. Natl. Acad. Sci. U.S.A., 2003. 100(8): p. 4945-50
    [PMID:12684538]
  5. Lee S, et al.
    Alteration of floral organ identity in rice through ectopic expression of OsMADS16.
    Planta, 2003. 217(6): p. 904-11
    [PMID:12905025]
  6. Xiao H, et al.
    Functional analysis of the rice AP3 homologue OsMADS16 by RNA interference.
    Plant Mol. Biol., 2003. 52(5): p. 957-66
    [PMID:14558657]