PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g49830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SRS
Protein Properties Length: 360aa    MW: 34954.4 Da    PI: 8.4207
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g49830.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702216.56.1e-671292864154
            DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa......aeaaskrkrelkskkqs.alsst 89 
                        ++sCqdCGn+akkdC+h RCRtCC+srgf+CathvkstWvpaakrrerqqqlaa+ + aaa++      a+aaskr+rel  +     +++t
  LOC_Os06g49830.1 129 AGTSCQDCGNNAKKDCSHLRCRTCCRSRGFSCATHVKSTWVPAAKRRERQQQLAALFRGAAANNsaaaaaAAAASKRPRELVRTLGRlPSANT 221
                       4579***************************************************99999888878887778889999998443332033344 PP

            DUF702  90 klssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                        ++ +++++     ++P+e+s+eavfrcvr+++vd++++elaYqtavsigGh+fkGiL+d+G+++
  LOC_Os06g49830.1 222 AMVATTTSSGEGDGRFPPELSVEAVFRCVRIGAVDEADAELAYQTAVSIGGHTFKGILRDHGPAD 286
                       444455555666778***********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.0E-63130285IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.9E-24132174IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016247.9E-20236284IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010252Biological Processauxin homeostasis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048479Biological Processstyle development
GO:0048480Biological Processstigma development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MAGFSLRGGG GGGGGGGGVG GGGGGGRGGE RGGGGDHAIG ADSLFLYARG AAAAAADTAG  60
SGGGGGGIGF QLWHPQQQAA AAAAAVPHTS QFFSSGVATG VVLGFSSHDG GGGGGHMGGP  120
GGGAGGGRAG TSCQDCGNNA KKDCSHLRCR TCCRSRGFSC ATHVKSTWVP AAKRRERQQQ  180
LAALFRGAAA NNSAAAAAAA AASKRPRELV RTLGRLPSAN TAMVATTTSS GEGDGRFPPE  240
LSVEAVFRCV RIGAVDEADA ELAYQTAVSI GGHTFKGILR DHGPADEAAG QLPPSSAEYH  300
QLTGQGREES SPAGSSEGVG GGHGAATAAT SAAVLMDPYP TPIGAFAAGT QFFPHNPRT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1626RGGGGGGGGGGGVGGGGGGGR
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154699190.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00613PBMTransfer from AT3G51060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g49830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g49830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0054630.0AP005463.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0712G01.
GenBankAP0043290.0AP004329.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OJ1663_H12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642175.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9SD401e-61SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A0E0AEA31e-172A0A0E0AEA3_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g49830.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18721140
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.13e-54Lateral root primordium (LRP) protein-related