PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g49040.1
Common NameLOC4341990, OJ1215_E11.18, Os06g0703900, OsJ_22555, OSNPB_060703900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 480aa    MW: 52205 Da    PI: 6.0972
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g49040.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.2e-32269323155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+rlrWt eLHerFveav++L G+ekAtPk +l+lmkv+gLt++hvkSHLQkYRl
  LOC_Os06g49040.1 269 KARLRWTLELHERFVEAVNKLDGPEKATPKGVLKLMKVEGLTIYHVKSHLQKYRL 323
                       68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.393266326IPR017930Myb domain
SuperFamilySSF466897.88E-17267323IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-30267324IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-24269324IPR006447Myb domain, plants
PfamPF002493.9E-8271322IPR001005SANT/Myb domain
PfamPF143793.6E-22359404IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MSSQSVVAVK QITAPDKIVE TCPSTKHSAH KLFDVKPDFQ GLIDDNLSSS SQSSSIKIEL  60
IRSSSLPNIL PFQKRSSEPE PESPLSHVSH PNVSEPVYSN SSTFCTSLFS SSSMETEPCR  120
QLGTLPFLPH PPKCEQQVSA GHSSSSSLLV PGGDGDIGNA HDEPEQSDDL KDFLNLSGGD  180
ASDGSFHGEN NAMAFAEQME FQFLSEQLGI AITDNEESPR LDDIYGTPPQ LSSLPVSSCS  240
NQSVQKAGSP VKVQLSSPRS SSGSATTNKA RLRWTLELHE RFVEAVNKLD GPEKATPKGV  300
LKLMKVEGLT IYHVKSHLQK YRLAKYLPET KEDKKASSED KKSQSGSSGN DSVKKKNLQV  360
AEALRMQMEV QKQLHEQLEV QRQLQLRIEE HARYLQRILE EQHKVSISSN SLSLKPPAES  420
QPESPKPTSE KKEAESEAGA ATSAQPSSED KSPDAECKSS PPVGSKRARV HVGDEHQCS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.52790.0flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329779680.0
Expression AtlasQ5Z811-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g49040.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g49040
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0679500.0AK067950.1 Oryza sativa Japonica Group cDNA clone:J013127L15, full insert sequence.
GenBankAK0606480.0AK060648.1 Oryza sativa Japonica Group cDNA clone:001-027-G12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644151.10.0PREDICTED: protein PHR1-LIKE 1
TrEMBLQ5Z8110.0Q5Z811_ORYSJ; Os06g0703900 protein
STRINGLOC_Os06g49040.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP45263769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.21e-66G2-like family protein