PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g49010.6
Common NameLOC4341986, OJ1215_E11.11, Os06g0703500, OsJ_22552, SPL12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 476aa    MW: 50742.7 Da    PI: 9.0148
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g49010.6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.9e-41180256278
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       CqvegC++dls+a+eyhr+hkvCe+hskap+v+vsgle+rfCqqCsrfh l efD++k+sCrrrL++hn+rrrk+q+
  LOC_Os06g49010.6 180 CQVEGCKVDLSSAREYHRKHKVCEAHSKAPKVIVSGLERRFCQQCSRFHGLAEFDQKKKSCRRRLSDHNARRRKPQQ 256
                       **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-33172241IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.496177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.24E-38179259IPR004333Transcription factor, SBP-box
PfamPF031101.7E-31180253IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009047anatomystem
PO:0007010developmental stagewhole plant fruit ripening stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MASFGMNWNQ KSPVFWDWEN PAPFGPNTME NPKSIPHPEP RGVVVAAANH GSTNSSGGTF  60
TSSSELANGS SKSSLSASFD SSSKLGNSLE FRFASVKGHG KNMCKDGEAG RVEDSGTSPA  120
VAVSHGEPVI GLKLGKRTYF ENVCGGQNVK SSSAASGVTC PSTVVKKMKV SQQSTQSSYC  180
QVEGCKVDLS SAREYHRKHK VCEAHSKAPK VIVSGLERRF CQQCSRFHGL AEFDQKKKSC  240
RRRLSDHNAR RRKPQQEAIS FGSSRLATMF YDARQQTDIY FGQSPFGQVR SNAISSCDNL  300
GGFKFTEAKL PWMKPMKTIG LEDLNFSTLQ MPGNVVSHTV HHHDFDGLIP FKGNTPKVLN  360
QGVDPACAVV SSNSNGAPDL RRALSLLSSD SWGPADVQAG SQVHPGGVMP PLAVAAATVT  420
APTNPVSVMH ALHPSTGGGG FWQDGDDPPP LDHASQAQAF MHPGNGSSSG YGHLH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-281802531184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1235252KKKSCRRRLSDHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.112150.0callus| flower| leaf| panicle| root| stem| vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329832020.0
Expression AtlasQ5Z818-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g49010.6
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g49010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1021360.0AK102136.1 Oryza sativa Japonica Group cDNA clone:J033085H14, full insert sequence.
GenBankAK0731790.0AK073179.1 Oryza sativa Japonica Group cDNA clone:J033004F21, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643462.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643461.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643459.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643458.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643457.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643456.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643455.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643454.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643453.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643452.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643451.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643450.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643449.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_015643448.10.0PREDICTED: squamosa promoter-binding-like protein 12
SwissprotQ5Z8180.0SPL12_ORYSJ; Squamosa promoter-binding-like protein 12
TrEMBLA0A0E0Q2B30.0A0A0E0Q2B3_ORYRU; Uncharacterized protein
STRINGLOC_Os06g49010.10.0(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-51squamosa promoter binding protein-like 2
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]