PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g48290.1
Common NameHOX18, Os06g0698200, OsJ_021636, P0028E05.36
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family HD-ZIP
Protein Properties Length: 257aa    MW: 27591 Da    PI: 9.2567
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g48290.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.97.1e-18114168256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ ++tkeq + Le+ F+ ++ +s++++ eLA++l+L+ rqV vWFqNrRa+ k
  LOC_Os06g48290.1 114 RKKLQLTKEQSTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTK 168
                       778899***********************************************98 PP

2HD-ZIP_I/II1171.1e-37114201188
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                       +kk++l+keq++lLE+sF+ ++ L++ +K+elar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een++L++e  eLr
  LOC_Os06g48290.1 114 RKKLQLTKEQSTLLEDSFRVHNILSHAQKHELARQLKLKPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTEENKQLKHELMELR 201
                       69*************************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-1894171IPR009057Homeodomain-like
SuperFamilySSF466897.27E-1998171IPR009057Homeodomain-like
PROSITE profilePS5007117.038110170IPR001356Homeobox domain
SMARTSM003892.4E-13112174IPR001356Homeobox domain
CDDcd000861.14E-12114171No hitNo description
PfamPF000463.4E-15114168IPR001356Homeobox domain
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
SMARTSM003402.0E-16170213IPR003106Leucine zipper, homeobox-associated
PfamPF021831.9E-9170202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MEGEDLGSWL GLGIGGGGYA YGGDDCRRSP SSPSPVQMLF SQHVKEEITR GYDHGRDEEQ  60
ASGSKIMKGE RGARLRVMRS IRNSGGDGSR SRVLSLGDDG GDGGSGGGGG GGTRKKLQLT  120
KEQSTLLEDS FRVHNILSHA QKHELARQLK LKPRQVEVWF QNRRARTKLK QTEVDCEFLK  180
RCCESLTEEN KQLKHELMEL RRLASPAAAA AGSQLYVQFP RAAAAAMVNV CPSCEKVTVM  240
GGGGGETGKS SSSYSS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1162170RRARTKLKQ
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5Z6F6
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g48290.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g48290
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0054450.0AP005445.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0028E05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643687.10.0PREDICTED: homeobox-leucine zipper protein HOX18
SwissprotQ5Z6F60.0HOX18_ORYSJ; Homeobox-leucine zipper protein HOX18
TrEMBLA0A0E0ADT90.0A0A0E0ADT9_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g48290.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19616156
MonocotsOGMP81303448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-46homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Agalou A, et al.
    A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members.
    Plant Mol. Biol., 2008. 66(1-2): p. 87-103
    [PMID:17999151]