PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g46560.1
Common NameLOC4341850, Os06g0679400, OSNPB_060679400, P0003H08.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 448aa    MW: 47370.7 Da    PI: 6.9096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g46560.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.6e-172875148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+ Ed+llvd v+++G g+W+++ r+ g+ R++k+c++rw ++l
  LOC_Os06g46560.1 28 KGPWTQAEDKLLVDHVRRHGEGNWNAVRRETGLQRCGKSCRLRWANHL 75
                      79******************************************9986 PP

2Myb_DNA-binding44.73.1e-1481124146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g+++++E+ l+++++ +lG++ W++I++++  gRt++++k++w++
  LOC_Os06g46560.1  81 KGPFSPDEERLILRLHGLLGNK-WARISSYLH-GRTDNEIKNYWNT 124
                       79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0752375IPR017930Myb domain
SuperFamilySSF466894.12E-3025122IPR009057Homeodomain-like
SMARTSM007171.6E-132777IPR001005SANT/Myb domain
PfamPF002497.4E-152875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-222982IPR009057Homeodomain-like
CDDcd001671.09E-113075No hitNo description
PROSITE patternPS0017504352IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129424.66376130IPR017930Myb domain
SMARTSM007171.7E-1480128IPR001005SANT/Myb domain
PfamPF002491.3E-1381124IPR001005SANT/Myb domain
CDDcd001672.87E-1083126No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2383130IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0025281anatomypollen
PO:0001015developmental stageK second mitotic division stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MARSGGGNGG GEGGGGGGNG GGGGGLKKGP WTQAEDKLLV DHVRRHGEGN WNAVRRETGL  60
QRCGKSCRLR WANHLRPDLR KGPFSPDEER LILRLHGLLG NKWARISSYL HGRTDNEIKN  120
YWNTRLKRRV RAGLTPYPPE IEREIAHLRA QNLNLSAEGG GGGGGMLPPP LLLDPSNPFA  180
LQQAPVVAPS PSASQANSPP LINQNYPLLN QMQGLQLLHL ANHQQAPPPQ QQQQQQPAFH  240
HHHDGGGGGG FVSSGLPPLP NRPRELPSNQ FETATSGGGG GCDALLESLL LGDDHLLPRP  300
NPAMLRVGSM PELMYREPSS SHVLHGGGGG GGASDSDVTS QYPPGEEDPH YGGRWDFIFE  360
DVKPKRKAAS AVEEISGMFG IAPGSIPGEW FNPGGVGSAA AAAGGSSAPS PGPSSVVTTD  420
DDFTLEMQQI MSSLPLLQPE EHHNWNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28261305108B-MYB
1h8a_C1e-282613025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1124130RLKRRVR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.56620.0flower| leaf| panicle| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379883600.0
Expression AtlasQ655P0-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g46560.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g46560
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1116970.0AK111697.1 Oryza sativa Japonica Group cDNA clone:J023004F23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641592.10.0PREDICTED: uncharacterized protein LOC4341850
TrEMBLQ655P00.0Q655P0_ORYSJ; Os06g0679400 protein
STRINGLOC_Os06g46560.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.15e-57myb domain protein 101