PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g46270.1
Common NameB1153E06.1, LOC4341823, Os06g0675600, OSNPB_060675600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 305aa    MW: 34083.7 Da    PI: 7.8228
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g46270.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.9e-51141521128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkk...lelee............vikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknrat 78 
                       lppGfrFhP+d+elv +yL++k+ +                      v+ +vd++k+ePwdLp+ +  + kewyf+s rd+kyatg+r+nrat
  LOC_Os06g46270.1  14 LPPGFRFHPRDDELVLDYLERKLLDGGvggA---AaaaaavtiygcpVMVDVDLNKCEPWDLPEIACVGGKEWYFYSLRDRKYATGQRTNRAT 103
                       79*********************99996651...23445667788878***************7666689*********************** PP

               NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +sgyWkatgkd+++ + kg lvg++ktLvfykgrapkg+kt+Wvmhe+r 
  LOC_Os06g46270.1 104 ESGYWKATGKDRPISR-KGLLVGMRKTLVFYKGRAPKGKKTEWVMHEFRK 152
                       **************99.999****************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-594175IPR003441NAC domain
PROSITE profilePS5100553.89514175IPR003441NAC domain
PfamPF023652.3E-2515151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009089anatomyendosperm
PO:0007042developmental stagewhole plant fruit formation stage
PO:0007633developmental stageendosperm development stage
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MSGMNSLSMV EARLPPGFRF HPRDDELVLD YLERKLLDGG VGGAAAAAAA VTIYGCPVMV  60
DVDLNKCEPW DLPEIACVGG KEWYFYSLRD RKYATGQRTN RATESGYWKA TGKDRPISRK  120
GLLVGMRKTL VFYKGRAPKG KKTEWVMHEF RKEGQGDPMK LPLKEDWVLC RVFYKSRTTI  180
AKLPTEGSYN NIDSVATTSL PPLTDNYIAF DQPGSMQNLE GYEQVPCFSN NPSQQPSSSM  240
NVPLTSAMVD QEQNNMGRAI KDVLSQFTKF EGNVKREALQ SNFSQDGFDY LAESGFTQMW  300
NSLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-491017611169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.517620.0callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329736660.0
Expression AtlasQ653V8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g46270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g46270
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0636480.0AK063648.1 Oryza sativa Japonica Group cDNA clone:001-119-A03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643122.10.0PREDICTED: NAC domain-containing protein 21/22
RefseqXP_015643121.10.0PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE66e-91NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0E0GD240.0A0A0E0GD24_ORYNI; Uncharacterized protein
TrEMBLQ653V80.0Q653V8_ORYSJ; Os06g0675600 protein
STRINGLOC_Os06g46270.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP101237138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-89NAC domain containing protein 1