PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g45890.1
Common NameLOC4341803, Os06g0670300, OSNPB_060670300, P0485A07.2, P0686E06.38
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 257aa    MW: 28507.6 Da    PI: 6.6752
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g45890.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.15.3e-301871255
           G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                      pr+rWt+e+H++Fveave LGG+++AtPk+il+lm+vkg++++h+kSHLQ+YR+
  LOC_Os06g45890.1 18 PRMRWTEEMHRQFVEAVECLGGQDEATPKRILQLMGVKGVSISHIKSHLQMYRS 71
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.3731474IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-281472IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-231871IPR006447Myb domain, plants
SuperFamilySSF466891.16E-161871IPR009057Homeodomain-like
PfamPF002494.9E-71970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGGFERRGVR QYNRSEVPRM RWTEEMHRQF VEAVECLGGQ DEATPKRILQ LMGVKGVSIS  60
HIKSHLQMYR SGSSNSNHPV SLQKLTSATV NNISKREFVN SEDRCIYASG DRNTASSDKN  120
TYTILRCGRS SMPSIEEIFR NWEQTRGRLL PWNSNVITTE QATTRASRQT TNYSKPLKQL  180
TDCDLTLSIG QLWDDAAGSD ADGSSTISEE VAAPSRDEAF VSSADDHFAA AAAKKESNML  240
TTDLNLDLTI SSSWLS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.531360.0callus| flower| leaf| panicle| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1154694570.0
Expression AtlasQ653M8-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g45890.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g45890
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4067630.0CU406763.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C005B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641452.10.0PREDICTED: probable transcription factor KAN3
TrEMBLA2YG180.0A2YG18_ORYSI; Putative uncharacterized protein
TrEMBLQ653M80.0Q653M8_ORYSJ; Os06g0670300 protein
STRINGBGIOSGA023442-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g45890.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.11e-27G2-like family protein