PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g45840.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 344aa    MW: 36246 Da    PI: 7.1656
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g45840.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.28.1e-1379123147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r +WT+ E++++++a +++  + Wk+I +++g  +t  q++s+ qky
  LOC_Os06g45840.1  79 RESWTEPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 123
                       789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.51E-1673129IPR009057Homeodomain-like
PROSITE profilePS5129414.62874128IPR017930Myb domain
TIGRFAMsTIGR015571.3E-1877126IPR006447Myb domain, plants
SMARTSM007172.7E-1078126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-678119IPR009057Homeodomain-like
PfamPF002491.3E-1079123IPR001005SANT/Myb domain
CDDcd001678.89E-881124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MVSMSATPNP IDASVVSAAA AVAGGGGGGD GGGGGGGKEK EKQVVAAPLQ PPMAVPAPAA  60
AVGEEARKVR KPYTITKSRE SWTEPEHDKF LEALQLFDRD WKKIEAYVGS KTVIQIRSHA  120
QKYFLKVQKN GTGEHLPPPR PKRKAAHPYP QKASKNACAV SPAAISQPPP LGEQGCVMSM  180
DTSPVIRNTN ASAVVPSWDN SIAQPLSASR TQGTGAVATN NCSSSIESPS TTWPTSEAVE  240
QENMLRPLRA MPDFAQVYSF LGSIFDPDTS GHLQTLKAMD PIDVETVLLL MRNLSMNLTS  300
PNFAAHLSLL SSCNSGGDPI KSEGMENLGS PQSCHLPFMV TSE*
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g45840.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g45840
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0708710.0AK070871.1 Oryza sativa Japonica Group cDNA clone:J023073K02, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015643724.10.0PREDICTED: protein REVEILLE 6 isoform X1
SwissprotQ8H0W32e-97RVE6_ARATH; Protein REVEILLE 6
TrEMBLI1Q4H70.0I1Q4H7_ORYGL; Uncharacterized protein
STRINGLOC_Os06g45840.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9281558
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.27e-84MYB_related family protein