PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g45410.1
Common NameLOC4341774, OsJ_22275
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 366aa    MW: 39577.8 Da    PI: 8.9881
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g45410.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.12e-3356110155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       kprlrWt eLH+rFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  LOC_Os06g45410.1  56 KPRLRWTVELHDRFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 110
                       79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.87653113IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-3253111IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1655112IPR009057Homeodomain-like
TIGRFAMsTIGR015577.5E-2456111IPR006447Myb domain, plants
PfamPF002492.2E-758108IPR001005SANT/Myb domain
PfamPF143792.7E-24148194IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MFPSSSPSPS PSSSKKQQQL SGGVGVGGAA AAASSNDRPP LCVQGDSGLV LTTDPKPRLR  60
WTVELHDRFV DAVTQLGGPD KATPKTIMRV MGVKGLTLYH LKSHLQKFRL GKQHKDFNDH  120
SVKDAMDMQR NAASSSGIMG RSMNDRSVHV NEALRMKMEV QRRFHEQLEV QKHLQMRVEA  180
QGKYMQTILE KAYQAISSSG DCATWHAGYK SLGSQAVLDI GSSMSFPSLQ DDLQLYGGSH  240
LDHLHQQHEQ MEIRPSIDTF LAFNYSSSTG KSPMVWPGAD DGGGEPAKIS GDHQLQMAAP  300
ATTTMMMEAI TMSGGDSMGS KGFEGQMSSK LDMRSPPPQQ TVLPVGSERM SSPIVGAKAR  360
NISYG*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.500030.0callus| leaf| panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379892110.0
Expression AtlasB9FQD7-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g45410.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g45410
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1195880.0AK119588.1 Oryza sativa Japonica Group cDNA clone:002-117-C12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642102.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK51e-85APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0E0Q1B10.0A0A0E0Q1B1_ORYRU; Uncharacterized protein
TrEMBLB9FQD70.0B9FQD7_ORYSJ; Uncharacterized protein
STRINGLOC_Os06g45410.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
MonocotsOGMP25043890
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-83G2-like family protein