PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g45310.1
Common NameLOC107276066, Os06g0663500, OsJ_021400, OSJNBb0065C04.42, SPL11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 344aa    MW: 37344.3 Da    PI: 7.7435
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g45310.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP116.31.6e-3666143178
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       +CqvegC  +l   key+r+h+vCe h+k+  v+v+g+ +rfCqqCsrfh+ sefD+ekrsCrrrL++hn+rrrk+q+
  LOC_Os06g45310.1  66 RCQVEGCGLELGGYKEYYRKHRVCEPHTKCLRVVVAGQDRRFCQQCSRFHAPSEFDQEKRSCRRRLSDHNARRRKPQT 143
                       6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.7E-2962128IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.87264141IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-3665147IPR004333Transcription factor, SBP-box
PfamPF031101.1E-2867140IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009030anatomycarpel
PO:0007130developmental stagesporophyte reproductive stage
PO:0007606developmental stagegynoecium development stage
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MECNPVSSTT SSSLLWDWDA TASAEPPPPP GKRGGRDSSS ASASAKRGRS AAAAGDAAAV  60
AAEAPRCQVE GCGLELGGYK EYYRKHRVCE PHTKCLRVVV AGQDRRFCQQ CSRFHAPSEF  120
DQEKRSCRRR LSDHNARRRK PQTDVFAFGS GTLPRSLFDD RQQISFAWDN NAPLNHANTT  180
SSSSWTSDLQ LSQVMDISKR SRKAGADSAN IRLSNALPTL CHDTNELLPI KGADASETAS  240
KLDGALDVQR ALSLLSASSR GLTDPGHQTS SIIQFTNSNQ NSTLPSVPSE GNSNVPFWVD  300
GQHQAVEPQV FQFTMDTGNT VFPDLERIKP SYESSMFGLN QIH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-22671401184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.91490.0vegetative meristem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977251560.0
Expression AtlasQ653Z5-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g45310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g45310
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0047440.0AP004744.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBb0065C04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641499.10.0PREDICTED: squamosa promoter-binding-like protein 11
SwissprotQ653Z50.0SPL11_ORYSJ; Squamosa promoter-binding-like protein 11
TrEMBLA0A0E0Q1950.0A0A0E0Q195_ORYRU; Uncharacterized protein
STRINGLOC_Os06g45310.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.43e-40squamosa promoter binding protein-like 10
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]