PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g44860.1
Common NameB1047G05.25, LOC4341729, Os06g0659100, SPL10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SBP
Protein Properties Length: 427aa    MW: 44291.9 Da    PI: 9.1299
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g44860.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.14e-41180256177
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       +Cq+egC+adls ak+yhrrhkvCe h+ka+vv++sg++qrfCqqCsrfh l+efDe+krsCr+rLa+hn+rrrk++
  LOC_Os06g44860.1 180 RCQAEGCKADLSGAKHYHRRHKVCEYHAKASVVAASGKQQRFCQQCSRFHVLTEFDEAKRSCRKRLAEHNRRRRKPA 256
                       6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.6E-35173242IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.547178255IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.15E-38179257IPR004333Transcription factor, SBP-box
PfamPF031104.2E-31181254IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MMSGRMNAAG DESPFPFGAM QAPGPGAYVG FDHGAAAVAA AAAAAQRAGM LQHHHHHMYD  60
GLDFAAAMQF GGGQDAPPHP QLLALPPSMA APPPPPMPMP LQMPMTMPMP GDVYPALGIV  120
KREGGGGGQD AAAGRIGLNL GRRTYFSPGD MLAVDRLLMR SRLGGVFGLG FGGAHHQPPR  180
CQAEGCKADL SGAKHYHRRH KVCEYHAKAS VVAASGKQQR FCQQCSRFHV LTEFDEAKRS  240
CRKRLAEHNR RRRKPAAAAT TAVAAAKDAA AAPVAAGKKP SGGAATSYTG DNKNVVSMSA  300
AKSPISSNTS VISCLPEQGK HAAAAARPTA LTLGGAPPHE SSAPQIGAML HHHHHHQQDH  360
MQVSSLVHIN GGGGGGSNNI LSCSSVCSSA LPSTATNGEV SDQNNDNSHN NGGNNNNMHL  420
FEVDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-301812541184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1237254KRSCRKRLAEHNRRRRKP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.910780.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ0DAE8
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf sheaths, and young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g44860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g44860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0057600.0AP005760.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:B1047G05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642406.10.0PREDICTED: squamosa promoter-binding-like protein 10
SwissprotA2YFT90.0SPL10_ORYSI; Squamosa promoter-binding-like protein 10
SwissprotQ0DAE80.0SPL10_ORYSJ; Squamosa promoter-binding-like protein 10
TrEMBLA0A0E0Q1300.0A0A0E0Q130_ORYRU; Uncharacterized protein
STRINGLOC_Os06g44860.10.0(Oryza sativa Japonica Group)
STRINGBGIOSGA023408-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.12e-45squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Xie K,Wu C,Xiong L
    Genomic organization, differential expression, and interaction of SQUAMOSA promoter-binding-like transcription factors and microRNA156 in rice.
    Plant Physiol., 2006. 142(1): p. 280-93
    [PMID:16861571]
  2. Yang Z, et al.
    Comparative study of SBP-box gene family in Arabidopsis and rice.
    Gene, 2008. 407(1-2): p. 1-11
    [PMID:17629421]