PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g44450.1
Common NameP0709F06.19
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 372aa    MW: 39190.1 Da    PI: 6.616
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g44450.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box217e-075398342
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       ++C+ +e  ++   C+ +   lC+ C   +H        H +vp+
  LOC_Os06g44450.1 53 VWVCEVCEVAPAAVTCKADAAVLCAACDADIHDAnplarrHARVPV 98
                      689*****************************44677777888775 PP

2CCT70.34.7e-24295338144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+l+RY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k+a
  LOC_Os06g44450.1 295 REARLMRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRA 338
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.11050IPR000315B-box-type zinc finger
SMARTSM003366.0E-135198IPR000315B-box-type zinc finger
PROSITE profilePS5011910.3815198IPR000315B-box-type zinc finger
CDDcd000212.61E-75498No hitNo description
PfamPF062038.5E-18295337IPR010402CCT domain
PROSITE profilePS5101716.896295337IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MMELRKYWGV GGRRCGACEA SPAAVHCRGC GGVYLCTACD ARPGHARAAH ERVWVCEVCE  60
VAPAAVTCKA DAAVLCAACD ADIHDANPLA RRHARVPVAP IGSAAAAAVA AEAMLFGVAA  120
AGAEAEAVED KAAAEHHHHQ QRQQHGALNL NVEAKDMKLD YLFSDLDPYL NVEFARFPHA  180
DSVVPNGAGA GAAIELDFTC GLGVGVGGAK QSYSSYTATD LAHSGSSSEV GVVPEAMCGG  240
GGAIDLDFTR PKPQPYMPYT ATPPPSHSVV SAQMSSSVVD VGVVPERAAA MGEGREARLM  300
RYREKRKNRR FEKTIRYASR KAYAETRPRI KGRFAKRADH DADDADADAD DPAAVPSSYM  360
LDFGYGVVPS F*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.79200.0flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2977251420.0
Expression AtlasQ67WB9-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g44450.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g44450
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4066130.0CU406613.1 Oryza rufipogon (W1943) cDNA clone: ORW1943C109H06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641209.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
TrEMBLQ67WB90.0Q67WB9_ORYSJ; Putative constans
TrEMBLA0A0E0Q1030.0A0A0E0Q103_ORYRU; Uncharacterized protein
TrEMBLI1Q4840.0I1Q484_ORYGL; Uncharacterized protein
STRINGLOC_Os06g44450.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
MonocotsOGMP38442348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.13e-18CONSTANS-like 2