PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g43910.1
Common NameLOC4341665, OJ1226_A12.26, ORR5, Os06g0647200, OSJNBa0062J02.10, RR25
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family ARR-B
Protein Properties Length: 695aa    MW: 76623.7 Da    PI: 5.8802
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g43910.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like79.63.8e-25186239155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       ++r++WtpeLH+ Fv av++L G ++A+P++il++mkv+ +t+e+++SHLQkYRl
  LOC_Os06g43910.1 186 RQRVVWTPELHRDFVIAVHEL-GVDRAVPRKILRMMKVDYMTRENIASHLQKYRL 239
                       58*******************.********************************8 PP

2Response_reg63.41.2e-21181261109
                       EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHH CS
      Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealk 91 
                       vl vdD+p+ ++ll+ +l++ +y + + ++d+  al++l+e+   +Dl++ D+ m +mdG++ll+ i  e  +lp+i+ +a+ge e++ + + 
  LOC_Os06g43910.1  18 VLAVDDSPVCLMLLEALLRRCKY-QPTMTRDAATALRMLRERPgdFDLVISDVHMLDMDGFKLLELIGLEM-DLPVIMQSANGELETMMKGVT 108
                       799********************.9999***********988888**********************6644.8******************** PP

                       TTESEEEESS--HHHHHH CS
      Response_reg  92 aGakdflsKpfdpeelvk 109
                        Ga d+l+Kp++ +++ +
  LOC_Os06g43910.1 109 HGACDYLVKPVSLKDIQN 126
                       ************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.13E-3214137IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.7E-3615164No hitNo description
SMARTSM004481.1E-2416128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011039.04817132IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.2E-1918126IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.44E-2219131No hitNo description
SuperFamilySSF466893.76E-18183243IPR009057Homeodomain-like
PROSITE profilePS5129410.269183242IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-26185244IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-23187239IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009072anatomyplant ovary
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MAATQATAAR KFPEGLRVLA VDDSPVCLML LEALLRRCKY QPTMTRDAAT ALRMLRERPG  60
DFDLVISDVH MLDMDGFKLL ELIGLEMDLP VIMQSANGEL ETMMKGVTHG ACDYLVKPVS  120
LKDIQNIWQH VWRKRKLDIR NHNGGYNDGG ELVGATRTKR KYTRKMRNDG DNYGENKENM  180
DSTLKRQRVV WTPELHRDFV IAVHELGVDR AVPRKILRMM KVDYMTRENI ASHLQKYRLY  240
LKRISTQTGM DPDQFPEKWK YMNELDALKN YCENGRYRLT PAIASSSSSN PFARMNSASA  300
LATNGFLPTH SVQLKNSQRN MAMGTVGHGG SPGNNPVFQP LQNSSNARKC FPSGPSGSSF  360
ANISNGLVLD TDDSGSSYAG MFCKSMWETS NGSPSCHSGN SSANKSNNGV SAPANQFQVQ  420
SKFGFSALAN QFPVQSNCGF SAPANQYQVQ SNGGFSVPAN QFPVQSNGEF LAPTNQFPVQ  480
YPEVNNQPLV QMNQSSTNHF STIGNDYQFP DLANCSKYWQ PTAPSMFPDL GHNDGTSFRP  540
SQANIANINQ LSSFAASSGQ EPMFGDELHG QMSPIMSTIS LSDFDDQMGS FNIGNDTSPA  600
EMMHDNFSLG SDSNISSSTP TDSSFGSTFP DFHLDSPEMP AQMLNGGDED GILLPVLDDT  660
VDQQDLFDQL DENNGREKLG SGRCVRKGPF ECFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-20185245464ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.803780.0callus
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ67W50
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g43910.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Dwarf, chlorina, lesion mimic, abnormal shoot, low tillering and low fertility phenotypes. {ECO:0000269|PubMed:16891544}.
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g43910
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0040080.0AP004008.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OJ1226_A12.
GenBankAP0035170.0AP003517.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0062J02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642402.10.0PREDICTED: two-component response regulator ORR25
SwissprotQ67W500.0ORR25_ORYSJ; Two-component response regulator ORR25
TrEMBLA0A0E0ACJ60.0A0A0E0ACJ6_9ORYZ; Uncharacterized protein
STRINGLOC_Os06g43910.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1239536
MonocotsOGMP135042132
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.13e-79response regulator 12
Publications ? help Back to Top
  1. Pareek A, et al.
    Whole-genome analysis of Oryza sativa reveals similar architecture of two-component signaling machinery with Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 380-97
    [PMID:16891544]
  2. Ito Y,Kurata N
    Identification and characterization of cytokinin-signalling gene families in rice.
    Gene, 2006. 382: p. 57-65
    [PMID:16919402]
  3. Schaller GE, et al.
    Nomenclature for two-component signaling elements of rice.
    Plant Physiol., 2007. 143(2): p. 555-7
    [PMID:17284581]