PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g43860.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 179aa    MW: 20474.8 Da    PI: 6.8075
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g43860.4genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.44.9e-081211542154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp++e++++L +++gL+ +q+ +WF N+R +
  LOC_Os06g43860.4 121 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 154
                       569*****************************87 PP

2ELK30.48.7e-117596122
               ELK  1 ELKhqLlrKYsgyLgsLkqEFs 22
                      ELKh+L+++Y+++L+++++E++
  LOC_Os06g43860.4 75 ELKHELKQGYREKLVDIREEIL 96
                      9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5121310.1967595IPR005539ELK domain
SMARTSM011880.00147596IPR005539ELK domain
PfamPF037891.3E-67596IPR005539ELK domain
PROSITE profilePS5007111.59695158IPR001356Homeobox domain
SuperFamilySSF466896.42E-1697162IPR009057Homeodomain-like
SMARTSM003893.3E-1097162IPR001356Homeobox domain
CDDcd000863.95E-1198159No hitNo description
Gene3DG3DSA:1.10.10.608.3E-25102159IPR009057Homeodomain-like
PfamPF059201.4E-18115154IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MEAVMACWEL EQTLQSLTGA SPREGSGATM SDDEDNQVDS ESNMFDGNDG SDGMGFGPLM  60
LTEGERSLVE RVRQELKHEL KQGYREKLVD IREEILRKRR AGKLPGDTAS TLKAWWQAHS  120
KWPYPTEEDK ARLVQETGLQ LKQINNWFIN QRKRNWHSNP ASSSSDKSKR KRYRVVDF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151171RKRNWHSNPASSSSDKSKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.46080.0flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO141491380.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g43860.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g43860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0618180.0AB061818.1 Oryza sativa Japonica Group HOS59 mRNA for KNOX family class 2 homeodomain protein, complete cds.
GenBankAB0076280.0AB007628.2 Oryza sativa Japonica Group HOS59 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644390.11e-125PREDICTED: homeobox protein knotted-1-like 11 isoform X2
SwissprotQ94LW41e-118KNOSB_ORYSJ; Homeobox protein knotted-1-like 11
TrEMBLA0A0E0Q0T81e-131A0A0E0Q0T8_ORYRU; Uncharacterized protein
STRINGORGLA06G0189900.11e-123(Oryza glaberrima)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.22e-99KNOTTED1-like homeobox gene 3