PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g43860.1
Common NameHOS59, LOC4341661, OJ1226_A12.18, Os06g0646600, OSJNBa0062J02.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family TALE
Protein Properties Length: 324aa    MW: 35106.3 Da    PI: 6.4504
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g43860.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.11.2e-072602932154
                       HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       k +yp++e++++L +++gL+ +q+ +WF N+R +
  LOC_Os06g43860.1 260 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 293
                       569*****************************87 PP

2ELK29.31.9e-10214235122
               ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                       ELKh+L+++Y+++L+++++E++
  LOC_Os06g43860.1 214 ELKHELKQGYREKLVDIREEIL 235
                       9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.6E-194589IPR005540KNOX1
PfamPF037901.6E-164885IPR005540KNOX1
SMARTSM012561.1E-25103158IPR005541KNOX2
PfamPF037916.8E-17111157IPR005541KNOX2
PfamPF037893.0E-6214235IPR005539ELK domain
PROSITE profilePS5121310.196214234IPR005539ELK domain
SMARTSM011880.0014214235IPR005539ELK domain
PROSITE profilePS5007111.596234297IPR001356Homeobox domain
SuperFamilySSF466899.41E-16236300IPR009057Homeodomain-like
SMARTSM003893.3E-10236301IPR001356Homeobox domain
CDDcd000868.62E-11237298No hitNo description
Gene3DG3DSA:1.10.10.602.5E-24241298IPR009057Homeodomain-like
PfamPF059203.5E-18254293IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MAFHYQDHAL AMDAAAAAAE TGGHHHPGFV GAGGVVGGGG GGGWEREKAA IAAHPLYERL  60
LEAHVACLRV ATPVDQLPRI DAQIAARPPP LAAATAAAAA AAAGGAPSGG EELDLFMTHY  120
VLLLCSFKEQ LQQHVRVHAM EAVMACWELE QTLQSLTGAS PREGSGATMS DDEDNQVDSE  180
SNMFDGNDGS DGMGFGPLML TEGERSLVER VRQELKHELK QGYREKLVDI REEILRKRRA  240
GKLPGDTAST LKAWWQAHSK WPYPTEEDKA RLVQETGLQL KQINNWFINQ RKRNWHSNPA  300
SSSSDKSKRK RSNAGDGKAE QSW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290310RKRNWHSNPASSSSDKSKRKR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.46080.0flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO141491380.0
Expression AtlasQ94LW4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Isoform 2 is expressed in roots, leaf blades, leaf sheaths and flowers. Isoform 4 is expressed in leaf blades and at lower levels in flowers. {ECO:0000269|PubMed:12034492}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g43860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g43860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2414380.0AK241438.1 Oryza sativa Japonica Group cDNA, clone: J065162G03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644389.10.0PREDICTED: homeobox protein knotted-1-like 11 isoform X1
SwissprotQ94LW40.0KNOSB_ORYSJ; Homeobox protein knotted-1-like 11
TrEMBLA0A0E0Q0T60.0A0A0E0Q0T6_ORYRU; Uncharacterized protein
STRINGLOC_Os06g43860.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP16717148
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-138KNOTTED1-like homeobox gene 3
Publications ? help Back to Top
  1. Ito Y,Hirochika H,Kurata N
    Organ-specific alternative transcripts of KNOX family class 2 homeobox genes of rice.
    Gene, 2002. 288(1-2): p. 41-7
    [PMID:12034492]
  2. Jain M,Tyagi AK,Khurana JP
    Genome-wide identification, classification, evolutionary expansion and expression analyses of homeobox genes in rice.
    FEBS J., 2008. 275(11): p. 2845-61
    [PMID:18430022]