PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g43090.1
Common NameLOC4341607, Os06g0637500, OSNPB_060637500, P0523F01.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 312aa    MW: 33377.3 Da    PI: 8.0957
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g43090.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.21e-191560147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg+W++eEde l ++v+++G ++W++I r+++ gR++k+c++rw + 
  LOC_Os06g43090.1 15 RGPWSPEEDEALRRLVERHGARNWTAIGREIP-GRSGKSCRLRWCNQ 60
                      89******************************.***********985 PP

2Myb_DNA-binding52.61e-1667109145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       r ++T+eEd  +++a+++lG++ W++Iar ++ gRt++ +k++w+
  LOC_Os06g43090.1  67 RRPFTAEEDATILRAHARLGNR-WAAIARLLQ-GRTDNAVKNHWN 109
                       679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.7461065IPR017930Myb domain
SuperFamilySSF466893.74E-3112108IPR009057Homeodomain-like
SMARTSM007172.2E-171463IPR001005SANT/Myb domain
PfamPF002498.6E-191560IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-261668IPR009057Homeodomain-like
CDDcd001672.09E-161759No hitNo description
SMARTSM007176.3E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129419.56367116IPR017930Myb domain
PfamPF002491.5E-1467109IPR001005SANT/Myb domain
CDDcd001673.05E-1169109No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2269116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0010200Biological Processresponse to chitin
GO:0048527Biological Processlateral root development
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009009anatomyplant embryo
PO:0001081developmental stagemature plant embryo stage
PO:0007042developmental stagewhole plant fruit formation stage
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGGGGGVEAD CDRIRGPWSP EEDEALRRLV ERHGARNWTA IGREIPGRSG KSCRLRWCNQ  60
LSPQVERRPF TAEEDATILR AHARLGNRWA AIARLLQGRT DNAVKNHWNC SLKRKLAVAT  120
TTTTTTTGAA AAPGVVADAA ELVERPCKRF SPTPDSPSGS GSGSDRSDLS HGGGFGQIFR  180
PVARTGAFEP VDCAISRRQE EDPFTSLSLS LPGTDQRFNH DSAHSHFQEL PSSPSPPPPP  240
PPAAAASTTQ YPFTPEFAAA MQEMIRAEVH KYMASVGVRA GCGDAGGADL HMPQLVEGVM  300
RAAAERVGRM H*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-38121164108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.545690.0callus| leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379911870.0
Expression AtlasQ67WF6-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00400DAPTransfer from AT3G50060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g43090.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g43090
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0035730.0AP003573.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0523F01.
GenBankAK1215640.0AK121564.1 Oryza sativa Japonica Group cDNA clone:J033034J16, full insert sequence.
GenBankAK1058170.0AK105817.1 Oryza sativa Japonica Group cDNA clone:001-203-C12, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641187.10.0PREDICTED: transcription factor MYB44
SwissprotQ9FDW13e-62MYB44_ARATH; Transcription factor MYB44
TrEMBLA2YFE40.0A2YFE4_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0HTX50.0A0A0E0HTX5_ORYNI; Uncharacterized protein
TrEMBLQ67WF60.0Q67WF6_ORYSJ; Os06g0637500 protein
STRINGBGIOSGA020819-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g43090.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP78938154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.18e-60myb domain protein 77