PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g41770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bZIP
Protein Properties Length: 373aa    MW: 40275.2 Da    PI: 4.8411
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g41770.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.52.2e-11210261455
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                       +k+ rr ++NR +A +sR+RKk++++ Le+k+k Leae ++L   l+    e
  LOC_Os06g41770.1 210 SKKKRRQMRNRDSAMKSRERKKMYVKDLETKSKYLEAECRRLSYALQCCAAE 261
                       79*************************************9998777665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.2E-12206270No hitNo description
SMARTSM003385.9E-6206271IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.737209251IPR004827Basic-leucine zipper domain
PfamPF001703.3E-10210267IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.88E-11211269No hitNo description
CDDcd147046.86E-14212263No hitNo description
PROSITE patternPS000360214229IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MTWHIQALPL AMPRHHPAWA PPPPFAETFP SSFLPKQNPS ISDESAIFKH THERQPTARD  60
KNISIAISMD VEFFADLDLD ALLASFSSSA AAAGSGVSGL FAPSPPHDAE AGSPESVSSR  120
RPSPSREAAL SEIERFLMEE GPAAEEGVGA EDFFDALLVD GGEEEEEEEG KGSEAGGSTD  180
GDSGKENEVA TPDAEKEDVE AEVDGDDPMS KKKRRQMRNR DSAMKSRERK KMYVKDLETK  240
SKYLEAECRR LSYALQCCAA ENMALRQSLL KDRPVGAATA MQESAVLTET LPLVSLLWLV  300
SIVCLLPVPG LPNRNPVARS SAGRDLATVT GKKTSSEQQL EETLLLHGRR CKGSRARIKL  360
DTGPFRLAAA AC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1210214KKKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.106860.0callus| flower| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329922300.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g41770.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g41770
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1070210.0AK107021.1 Oryza sativa Japonica Group cDNA clone:002-121-A01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641141.10.0PREDICTED: bZIP transcription factor 60
TrEMBLA0A0E0HTM70.0A0A0E0HTM7_ORYNI; Uncharacterized protein
STRINGLOC_Os06g41770.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP54681518
MonocotsOGMP69343750
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.14e-13basic region/leucine zipper motif 60