PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g40330.1
Common NameGAMYB-like1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 683aa    MW: 75878.9 Da    PI: 7.5607
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g40330.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.6e-18249296148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT++Ed++l ++v+ +G g+W+++ r  g++R++k+c++rw ++l
  LOC_Os06g40330.1 249 KGPWTPDEDKRLREYVEAHGEGNWNRVQRNAGLNRCGKSCRLRWANHL 296
                       79******************************************9986 PP

2Myb_DNA-binding41.72.7e-13302345146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       +g++++eE+e +++++  lG++ W++ a+ ++ gRt++++k++w++
  LOC_Os06g40330.1 302 KGPFSKEEEEMIIKLHLWLGNK-WAKMANSLP-GRTDNEIKNFWNT 345
                       79********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.639244300IPR017930Myb domain
SuperFamilySSF466894.12E-30246343IPR009057Homeodomain-like
SMARTSM007175.2E-16248298IPR001005SANT/Myb domain
PfamPF002496.3E-17249296IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-24250303IPR009057Homeodomain-like
CDDcd001677.62E-12251296No hitNo description
PROSITE profilePS5129416.24301351IPR017930Myb domain
SMARTSM007171.9E-12301349IPR001005SANT/Myb domain
PfamPF002495.8E-12302345IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-23304349IPR009057Homeodomain-like
CDDcd001672.07E-9304345No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MPRAAAPHGG LCLCRLRLRS RRARVVLKLQ QPAMQPDSTD RLAGRHAGCS ERAADILCKL  60
HRTKQMIVFR KFTTKSKKHS MQSCKPRLHR WIVLNPNGKP SPYTLTFQFP SRTPTLARTP  120
REARCKDFTH TVSIHRMPSR IQLRHPSTTL LRSPPPPPPP PPPTSSRRRM RMEGSSPMEE  180
EEEAARLAGS QGESPAMLHP NGDGDGDGGD DEGDASGGEE EQGGVARAGV RRRGGGGRVR  240
VRGRIPLKKG PWTPDEDKRL REYVEAHGEG NWNRVQRNAG LNRCGKSCRL RWANHLKPDL  300
KKGPFSKEEE EMIIKLHLWL GNKWAKMANS LPGRTDNEIK NFWNTRCKRI QRTGEPLYPK  360
EFNHFKLTDL EVMNCESPDE SRAKKRTNEV LQGNGQSYKE VFFDNLDYSR PENYIRPNCV  420
TPNSLPVDAT SPFGSAIATQ DQSVPFGSAI VSGHPILDGN FSTSGTIQRP MNVELPSLQY  480
PNYDFNNNNA WSYHDPLGHP IDQVDFGSLR SEYLSPNNNG LLDALVHGGH GQGELANSQG  540
SFDACFPRVQ CNQVIQSNAF SLSSSFPIIG DDLLENSCHA FVGINNNASS LFLDSQPPPL  600
VDPTFWRHDV SLEPNLPVYC QFNEELPPSN EQFAKDADDA FGHGGLSDET NLAAAGQGDE  660
HDLEDPWASM PGACDIPDFP SE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-272473495106B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.224690.0callus| flower| panicle| root| seed
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ3C253
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g40330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g40330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2120750.0AB212075.1 Oryza sativa Japonica Group mRNA for GAMYB-like1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641123.10.0PREDICTED: transcription factor GAMYB
TrEMBLQ3C2530.0Q3C253_ORYSJ; GAMYB-like1
STRINGLOC_Os06g40330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP129022331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.25e-54myb domain protein 101