PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g35140.1
Common NameB1068H08.25, LOC4341235, Os06g0543200, OsJ_21617, OSNPB_060543200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 544aa    MW: 58320.1 Da    PI: 6.2108
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g35140.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.81.9e-31127180255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       prlrWtp+LH +Fv+ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  LOC_Os06g35140.1 127 PRLRWTPDLHMAFVHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 180
                       8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.601123183IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-29123181IPR009057Homeodomain-like
SuperFamilySSF466895.38E-14126181IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-22127182IPR006447Myb domain, plants
PfamPF002499.5E-9128179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MGEVKENEVV EIFEHDHDNK IRSPENSVPP AMVLDLNEGF GEGSEEGGVG EDGDEEDDDE  60
DDDDDDDDDG GSTSEVAGGG RSSSNNSSTN HNSGSDKDHD MNSSSSKADG GGDRVPTVRQ  120
YNRSKLPRLR WTPDLHMAFV HAVERLGGQE RATPKLVLQM MNVRGLSIAH VKSHLQMYRS  180
KKLDHESGHE RGAISSVFSP MEFHMRRGDH RFHHHDMFFQ RAAAAGVSPF SSRMLHENGG  240
GFFASRNPGL PESSRLYGLF QRRQQAPMQK FDFKNCNSFS RNQEWAFNQQ HAAARAAGAV  300
NGHGPAKGLI HEMIFRKEGK PTSHLFDVRD AIASTRVTSA TTAAAADHRL DGAGKAGNFD  360
WIGSSSSRPL TRTMSAAAAA TMGDHHHLRW RGGAAGSGNT TASSDPVVAS EAALGSLLER  420
AKTKATEAMR LETPVKMTAA AVAAEEINGR TPDLQLSLSP NAGDHRSAGE KRKFLSEQEV  480
DSDKQQLPLT LSLSLRGGGD NGGGGGAEAA GRLEEEMTGS SSSKKAALGL STLDLTMSIK  540
ALE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.878130.0callus| root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329836290.0
Expression AtlasQ5Z6X2-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g35140.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g35140
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736060.0AK073606.1 Oryza sativa Japonica Group cDNA clone:J033048N17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641453.10.0PREDICTED: uncharacterized protein LOC4341235 isoform X1
TrEMBLQ5Z6X20.0Q5Z6X2_ORYSJ; MYB transcription factor-like
STRINGLOC_Os06g35140.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-34G2-like family protein