PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g33940.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 377aa    MW: 41411.8 Da    PI: 7.1204
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g33940.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.62e-52101391128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                       +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi+e+d++k+ePwdL+   ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk
  LOC_Os06g33940.1  10 VPPGFRFHPTDEELLYYYLRKKVAYEAIDL-DVIREIDLNKLEPWDLKDrcRIGTgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDK 101
                       69****************************.9***************943444442456********************************** PP

               NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++ ++   +g++ktLvfy grap+g+ktdW+mheyrl
  LOC_Os06g33940.1 102 AIFLANACRIGMRKTLVFYVGRAPHGKKTDWIMHEYRL 139
                       ************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-595159IPR003441NAC domain
PROSITE profilePS5100557.15410159IPR003441NAC domain
PfamPF023651.1E-2711139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MHPSGGALSV PPGFRFHPTD EELLYYYLRK KVAYEAIDLD VIREIDLNKL EPWDLKDRCR  60
IGTGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIFLANACR IGMRKTLVFY  120
VGRAPHGKKT DWIMHEYRLD QDNVDVQEDG WVVCRVFMKK SYQRGLNPAD MAAVDDDDLL  180
HHHHHPFPPA QLHGGAADHK HDGAGGHHHH HLMQPHHHYD DFPSFDPSMQ LPQLMSADQP  240
PPPPPSLLPG VPPSAAAALS SLDVECPQNL MKLTSAAAGG GATGLLHAGG DHRFATAATD  300
WSILDKLLAS HQNLDQLFQG RVIAGASSPA AMAAPSHHQH LMDQLAGGGG GTASSLQRLP  360
LQYLGCEAAD LLRFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-50816115167NAC domain-containing protein 19
4dul_A2e-50816115167NAC domain-containing protein 19
1ut7_B2e-50816115167NO APICAL MERISTEM PROTEIN
1ut7_A2e-50816115167NO APICAL MERISTEM PROTEIN
1ut4_B2e-50816115167NO APICAL MERISTEM PROTEIN
1ut4_A2e-50816115167NO APICAL MERISTEM PROTEIN
3swp_D3e-50816118170NAC domain-containing protein 19
3swp_C3e-50816118170NAC domain-containing protein 19
3swp_B3e-50816118170NAC domain-containing protein 19
3swp_A3e-50816118170NAC domain-containing protein 19
3swm_D3e-50816118170NAC domain-containing protein 19
3swm_C3e-50816118170NAC domain-containing protein 19
3swm_B3e-50816118170NAC domain-containing protein 19
3swm_A3e-50816118170NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.43860.0callus
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329874330.0
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g33940.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g33940
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281860.0AB028186.1 Oryza sativa mRNA for OsNAC7 protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644283.10.0PREDICTED: NAC domain-containing protein 76
SwissprotQ5Z6B61e-148NAC76_ORYSJ; NAC domain-containing protein 76
TrEMBLA0A0E0PYP40.0A0A0E0PYP4_ORYRU; Uncharacterized protein
STRINGLOC_Os06g33940.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP34613781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-87NAC family protein