PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g24070.1
Common NameGLK1, LOC4340977, Os06g0348800, OSJNBa0031J07.13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family G2-like
Protein Properties Length: 456aa    MW: 48514.6 Da    PI: 4.6827
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g24070.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.61.1e-27180234156
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                       k++++WtpeLH+rFv+aveqL G++kA+P++ile+m++++Lt+++++SHLQkYR++
  LOC_Os06g24070.1 180 KAKVDWTPELHRRFVQAVEQL-GIDKAVPSRILEIMGIDSLTRHNIASHLQKYRSH 234
                       6799*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.924177236IPR017930Myb domain
SuperFamilySSF466896.54E-19178237IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-27178237IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-26180234IPR006447Myb domain, plants
PfamPF002496.3E-8183232IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MLAVSPAMCP DIEDRAAVAG DAGMEVVGMS SDDMDQFDFS VDDIDFGDFF LRLEDGDVLP  60
DLEVDPAEIF TDFEAIATSG GEGVQDQEVP TVELLAPADD VGVLDPCGDV VVGEENAAFA  120
GAGEEKGGCN QDDDAGEANV DDGAAAVEAK SSSPSSTTSS SQEAESRHKS SSKSSHGKKK  180
AKVDWTPELH RRFVQAVEQL GIDKAVPSRI LEIMGIDSLT RHNIASHLQK YRSHRKHMIA  240
REAEAASWTQ RRQIYAAGGG AVAKRPESNA WTVPTIGFPP PPPPPPSPAP IQHFARPLHV  300
WGHPTMDPSR VPVWPPRHLV PRGPAPPWVP PPPPSDPAFW HHPYMRGPAH VPTQGTPCMA  360
MPMPAARFPA PPVPGVVPCP MYRPLTPPAL ASKNQQDAQL QLQVQPSSES IDAAIGDVLS  420
KPWLPLPLGL KPPSVDSVMG ELQRQGVANV PPACG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-17177232257ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.33400.0callus| leaf| panicle| root| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO139404970.0
Expression AtlasQ5Z5I4-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves. {ECO:0000269|PubMed:11340194}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional activator that promotes chloroplast development. Acts as an activator of nuclear photosynthetic genes involved in chlorophyll biosynthesis, light harvesting, and electron transport. {ECO:0000269|PubMed:19808806}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g24070.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By light. {ECO:0000269|PubMed:11340194}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g24070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1221610.0AK122161.1 Oryza sativa Japonica Group cDNA clone:J033147G01, full insert sequence.
GenBankAK0989090.0AK098909.1 Oryza sativa Japonica Group cDNA clone:J013002F22, full insert sequence.
GenBankAK0651840.0AK065184.1 Oryza sativa Japonica Group cDNA clone:J013002D22, full insert sequence.
GenBankAK0619460.0AK061946.1 Oryza sativa Japonica Group cDNA clone:001-042-E04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644244.10.0PREDICTED: probable transcription factor GLK1
SwissprotQ5Z5I40.0GLK1_ORYSJ; Probable transcription factor GLK1
TrEMBLA0A0E0PXK90.0A0A0E0PXK9_ORYRU; Uncharacterized protein
STRINGLOC_Os06g24070.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
MonocotsOGMP24153886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.12e-48GBF's pro-rich region-interacting factor 1
Publications ? help Back to Top
  1. Rossini L,Cribb L,Martin DJ,Langdale JA
    The maize golden2 gene defines a novel class of transcriptional regulators in plants.
    Plant Cell, 2001. 13(5): p. 1231-44
    [PMID:11340194]
  2. Nakamura H, et al.
    Ectopic overexpression of the transcription factor OsGLK1 induces chloroplast development in non-green rice cells.
    Plant Cell Physiol., 2009. 50(11): p. 1933-49
    [PMID:19808806]