PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g23950.1
Common NameB1077E08.32, OsJ_21264
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 78aa    MW: 8595.81 Da    PI: 10.2914
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g23950.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.34.1e-28959151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                      +rien++ rqvtfskRr g++KKA+EL +LCda+v v++fsstg+ly+ys+
  LOC_Os06g23950.1  9 SRIENTTSRQVTFSKRRSGLFKKAKELAILCDAQVGVLVFSSTGRLYDYSN 59
                      59***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.987161IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.67E-27365IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-26323IPR002100Transcription factor, MADS-box
CDDcd002653.71E-34364No hitNo description
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MVRGKTVISR IENTTSRQVT FSKRRSGLFK KAKELAILCD AQVGVLVFSS TGRLYDYSNS  60
SNSRNLTYDQ LLGDTVC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-15166166Myocyte-specific enhancer factor 2B
1tqe_Q1e-15166166Myocyte-specific enhancer factor 2B
1tqe_R1e-15166166Myocyte-specific enhancer factor 2B
1tqe_S1e-15166166Myocyte-specific enhancer factor 2B
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5Z5L9
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g23950.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g23950
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126145e-97CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankAP0149625e-97AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0056465e-97AP005646.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:B1077E08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641671.12e-36PREDICTED: MADS-box transcription factor 23-like
RefseqXP_015641670.12e-36PREDICTED: MADS-box transcription factor 23-like
SwissprotQ9SI385e-29ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLA0A0E0A9B38e-50A0A0E0A9B3_9ORYZ; Uncharacterized protein
TrEMBLA2YCP08e-50A2YCP0_ORYSI; Putative uncharacterized protein
TrEMBLQ5Z5L98e-50Q5Z5L9_ORYSJ; MADS-box protein-like
STRINGBGIOSGA022872-PA2e-49(Oryza sativa Indica Group)
STRINGLOC_Os06g23950.12e-49(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.22e-30AGAMOUS-like 16