PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g23650.1
Common NameLOC4340969, Os06g0344900, OSJNBa0021N09.15, OSNPB_060344900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family NAC
Protein Properties Length: 374aa    MW: 39174.2 Da    PI: 8.8051
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g23650.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.53.6e-55231501128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                       lppGfrFhPtdeel+++yL +kv + +++  ++i+e+d++k+ePw+Lp+k+k +ekewyf+s rd+ky+tg r+nrat +gyWkatgkd+e+ 
  LOC_Os06g23650.1  23 LPPGFRFHPTDEELITYYLLRKVVDGSFNG-RAIAEIDLNKCEPWELPEKAKMGEKEWYFYSLRDRKYPTGLRTNRATGAGYWKATGKDREIR 114
                       79*************************999.89***************99999**************************************** PP

               NAM  94 sk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                       s+ +g+lvg+kktLvfy+grapkg+kt+Wvmheyrl
  LOC_Os06g23650.1 115 SArTGALVGMKKTLVFYRGRAPKGQKTQWVMHEYRL 150
                       9868889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6122175IPR003441NAC domain
PROSITE profilePS5100559.81923175IPR003441NAC domain
PfamPF023655.2E-2824150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010072Biological Processprimary shoot apical meristem specification
GO:0010160Biological Processformation of organ boundary
GO:0010223Biological Processsecondary shoot formation
GO:0048366Biological Processleaf development
GO:0048504Biological Processregulation of timing of organ formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009049anatomyinflorescence
PO:0001083developmental stageinflorescence development stage
PO:0007006developmental stageIL.00 inflorescence just visible stage
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MERCSVLGLG GGGGGGGRLD GELPPGFRFH PTDEELITYY LLRKVVDGSF NGRAIAEIDL  60
NKCEPWELPE KAKMGEKEWY FYSLRDRKYP TGLRTNRATG AGYWKATGKD REIRSARTGA  120
LVGMKKTLVF YRGRAPKGQK TQWVMHEYRL DGTYAYHFLS SSTRDEWVIA RIFTKPGVFP  180
VVRKGRLGIS GGGGDTSCFS DSTSASVGGG GGTSASSALR APLAEASLFA AAAAPAVDGA  240
DSSNYGGGGG AGSATATANL VTGLELVPCF STTAHMDASF GTGQYNPAPL AVEPPPPPPA  300
FFPSLRSLQE NLQLPLFLSG GMQAGVSSQP LSGGGAFHWQ SGMDVKVEGA VGRAPPQMAV  360
GPGQLDGAFA WGF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-532317517165NAC domain-containing protein 19
4dul_A1e-532317517165NAC domain-containing protein 19
1ut7_B1e-532317517165NO APICAL MERISTEM PROTEIN
1ut7_A1e-532317517165NO APICAL MERISTEM PROTEIN
1ut4_B1e-532317517165NO APICAL MERISTEM PROTEIN
1ut4_A1e-532317517165NO APICAL MERISTEM PROTEIN
3swp_D2e-532317520168NAC domain-containing protein 19
3swp_C2e-532317520168NAC domain-containing protein 19
3swp_B2e-532317520168NAC domain-containing protein 19
3swp_A2e-532317520168NAC domain-containing protein 19
3swm_D2e-532317520168NAC domain-containing protein 19
3swm_C2e-532317520168NAC domain-containing protein 19
3swm_B2e-532317520168NAC domain-containing protein 19
3swm_A2e-532317520168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.184140.0panicle
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ5Z7R9
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00562DAPTransfer from AT5G53950Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g23650.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g23650
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0046790.0AP004679.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0021N09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642575.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1
SwissprotO040179e-95NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLQ5Z7R90.0Q5Z7R9_ORYSJ; Os06g0344900 protein
STRINGLOC_Os06g23650.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
MonocotsOGMP99403543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.15e-88NAC family protein