PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g22760.1
Common NameLOC107277639, Os06g0333700, OsJ_21209, OSJNBa0012F14.2, OSNPB_060333700, P0531C01.41
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 239aa    MW: 27025.1 Da    PI: 10.0929
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g22760.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.66.9e-18957149
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                      kri+n+  rqv fskRr  ++KKA+EL + C+aeva+++ s+ gk++ +
  LOC_Os06g22760.1  9 KRIKNEEARQVCFSKRRPSVFKKASELYTVCGAEVAMLVKSPAGKFFSF 57
                      79********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.862161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-23176IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-23160IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-15323IPR002100Transcription factor, MADS-box
PfamPF003199.6E-211057IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MTKRKIEIKR IKNEEARQVC FSKRRPSVFK KASELYTVCG AEVAMLVKSP AGKFFSFGAP  60
SVGFVLSRFH ATTTSRKHSS MGVTIQHDNS ATIKLHELNQ QHIELQNQLQ AQNEKMKALQ  120
EVAKKESGGK VMGWLNSKVE DICQEDLEEF KMVLESLKYL TRGIINQLFQ NYAMFSNMMR  180
VQHCVTALPN QQFLPSSEDV KPMIHHVPSS SYGWNTSIDS KPNSSDAHVV GARRYFPK*
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ69WG7
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g22760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g22760
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0047840.0AP004784.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0012F14.
GenBankAP0037630.0AP003763.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0531C01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642726.10.0PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A0E0PXB40.0A0A0E0PXB4_ORYRU; Uncharacterized protein
TrEMBLQ69WG70.0Q69WG7_ORYSJ; MADS-box protein-like
STRINGLOC_Os06g22760.11e-180(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
MonocotsOGMP169561112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.14e-24AGAMOUS-like 61