PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g16370.1
Common NameHD1, LOC4340746, Os06g0275000, P0038C05.23, P0676F10.34, SE1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 396aa    MW: 43075.4 Da    PI: 4.5913
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g16370.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.81.6e-063375440
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                      r C+ +   +   +C+ +  +lC++C    H        H++v
  LOC_Os06g16370.1 33 RPCDGCRAAPSVVYCRADAAYLCASCDARVHAAnrvasrHERV 75
                      67**************************999556677778766 PP

2zf-B_box21.83.9e-0775107335
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHk 35 
                        r+C+ +e+ ++ l C+ +   lC  C ++ H+
  LOC_Os06g16370.1  75 VRVCEACERAPAALACRADAAALCVACDVQVHS 107
                       689**************************9994 PP

3CCT66.38.8e-23326369144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea++lRY+eK+k RkFeK+irYe+RKa+Ae RpR+KGrF+k++
  LOC_Os06g16370.1 326 REARVLRYREKKKARKFEKTIRYETRKAYAEARPRIKGRFAKRS 369
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.3E-73077IPR000315B-box-type zinc finger
CDDcd000213.95E-93377No hitNo description
PROSITE profilePS5011910.1533577IPR000315B-box-type zinc finger
PROSITE profilePS501199.41473106IPR000315B-box-type zinc finger
PfamPF006431.2E-575107IPR000315B-box-type zinc finger
SMARTSM003360.09778116IPR000315B-box-type zinc finger
PfamPF062036.1E-17326368IPR010402CCT domain
PROSITE profilePS5101716.41326368IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048576Biological Processpositive regulation of short-day photoperiodism, flowering
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020039anatomyleaf lamina
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MNYNFGGNVF DQEVGVGGEG GGGGEGSGCP WARPCDGCRA APSVVYCRAD AAYLCASCDA  60
RVHAANRVAS RHERVRVCEA CERAPAALAC RADAAALCVA CDVQVHSANP LPAITIPATS  120
VLAEAVVATA TVLGDKDEEV DSWLLLSKDS DNNNNNNNNN DNDNNDNNNS NSSNNGMYFG  180
EVDEYFDLVG YNSYYDNRIE NNQDRQYGMH EQQEQQQQQQ EMQKEFAEKE GSECVVPSQI  240
TMLSEQQHSG YGVVGADQAA SMTAGVSAYT DSISNSISFS SMEAGIVPDS TVIDMPNSRI  300
LTPAGAINLF SGPSLQMSLH FSSMDREARV LRYREKKKAR KFEKTIRYET RKAYAEARPR  360
IKGRFAKRSD VQIEVDQMFS TAALSDGSYG TVPWF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.11890.0leaf
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ9FDX8
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flower development. Required for the promotion of flowering under short day (SD) conditions and the suppression of flowering under long day (LD) conditions. Regulates positively the floral activator HEADING DATE 3a (HD3A) under SD and negatively under LD conditions. {ECO:0000269|PubMed:12700762}.
Function -- GeneRIF ? help Back to Top
  1. Hd1 and Ehd1 together control the number of primary branches in the panicle.
    [PMID: 21565907]
  2. Heading date 1 (Hd1), an ortholog of Arabidopsis CONSTANS, is a possible target of human selection during domestication to diversify flowering times of cultivated rice
    [PMID: 21952207]
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g16370.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Expressed with a circadian rhythm showing a peak at night and then decreasing to reach the lowest levels around the middle of the day in LD conditions. The levels of expression in SD conditions are slightly lower. {ECO:0000269|PubMed:12700762}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g16370
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0418380.0AB041838.1 Oryza sativa Japonica Group mRNA for Hd1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641799.10.0PREDICTED: zinc finger protein HD1
SwissprotQ9FDX80.0HD1_ORYSJ; Zinc finger protein HD1
TrEMBLD1MWS60.0D1MWS6_ORYSA; Heading date1
TrEMBLG3LIY50.0G3LIY5_9ORYZ; Heading day 1
TrEMBLI3RVE50.0I3RVE5_ORYSJ; Hd1 (Fragment)
STRINGLOC_Os06g16370.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
MonocotsOGMP56223140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-64CONSTANS-like 2
Publications ? help Back to Top
  1. Yano M, et al.
    Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS.
    Plant Cell, 2000. 12(12): p. 2473-2484
    [PMID:11148291]
  2. Hayama R,Yokoi S,Tamaki S,Yano M,Shimamoto K
    Adaptation of photoperiodic control pathways produces short-day flowering in rice.
    Nature, 2003. 422(6933): p. 719-22
    [PMID:12700762]
  3. Doi K, et al.
    Ehd1, a B-type response regulator in rice, confers short-day promotion of flowering and controls FT-like gene expression independently of Hd1.
    Genes Dev., 2004. 18(8): p. 926-36
    [PMID:15078816]
  4. Matsubara K, et al.
    Novel QTLs for photoperiodic flowering revealed by using reciprocal backcross inbred lines from crosses between japonica rice cultivars.
    Theor. Appl. Genet., 2008. 117(6): p. 935-45
    [PMID:18726584]
  5. Endo-Higashi N,Izawa T
    Flowering time genes Heading date 1 and Early heading date 1 together control panicle development in rice.
    Plant Cell Physiol., 2011. 52(6): p. 1083-94
    [PMID:21565907]
  6. Takahashi Y,Shimamoto K
    Heading date 1 (Hd1), an ortholog of Arabidopsis CONSTANS, is a possible target of human selection during domestication to diversify flowering times of cultivated rice.
    Genes Genet. Syst., 2011. 86(3): p. 175-82
    [PMID:21952207]