PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g15330.1
Common NameLOC4340698, OsJ_20892
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family CO-like
Protein Properties Length: 449aa    MW: 48088.6 Da    PI: 4.8837
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g15330.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.46e-081859338
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      +r C+ + + +++++C  ++ +lC+ C ++ H+       H+
  LOC_Os06g15330.1 18 ARACDGCLRRRARWYCAADDAFLCQGCDTSVHSAnplarrHE 59
                      678*****************************6567777776 PP

2CCT67.34.1e-23391434144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  LOC_Os06g15330.1 391 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 434
                       9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.6231663IPR000315B-box-type zinc finger
SMARTSM003363.9E-111663IPR000315B-box-type zinc finger
PfamPF006431.2E-61860IPR000315B-box-type zinc finger
CDDcd000217.45E-91963No hitNo description
PROSITE profilePS5101716.083391433IPR010402CCT domain
PfamPF062037.6E-18391433IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MSSTAKAAAA GAVGAKSARA CDGCLRRRAR WYCAADDAFL CQGCDTSVHS ANPLARRHER  60
LRLRPSSPPP LVPPSGSGRR DEAVPAAWFK RKARTPRSHA AKSAAAFGQL LSRRLVVVPE  120
AAAGSGGDSP EERKDEGEIV EEQEQLLYRV PIFDPALSEF CSPPPLEDAA AAVSCCNEDG  180
AVENPTKPSM TTTTATTPPL QFFPDGQANF GPTDAELREF AADMEALLGR GLDDGNDEDS  240
FCMETLGLIE PVDDDAGRVK VEADGDAGMT LAWCHELDTE TSSGEMLDID FDCGSPQAAT  300
TPDEKVGSSG PAAADDDAQL QQSNLALSLN YEAIIESWGT SPWTDGERPH VKLDDSWPRD  360
YSGVWMAAAG VFGHGGEEQA LTPRLGMDGG REARVSRYRE KRRTRLFSKK IRYEVRKLNA  420
EKRPRMKGRF VKRAAAAATA AVATACVA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1401417RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.388480.0leaf| panicle| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976055440.0
Expression AtlasA3BAG5-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g15330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g15330
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2878360.0AK287836.1 Oryza sativa Japonica Group cDNA, clone: J065191O19, full insert sequence.
GenBankAK2412490.0AK241249.1 Oryza sativa Japonica Group cDNA, clone: J065129J23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641417.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16
TrEMBLA0A0E0PW360.0A0A0E0PW36_ORYRU; Uncharacterized protein
TrEMBLA3BAG50.0A3BAG5_ORYSJ; Uncharacterized protein
STRINGLOC_Os06g15330.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP8021649
MonocotsOGMP32833058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-61B-box type zinc finger protein with CCT domain