PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g14700.1
Common NameLOC107275562, Os06g0258200, OsJ_20871, OSNPB_060258200, P0603C10.27
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 179aa    MW: 19948.7 Da    PI: 11.6719
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g14700.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.1e-154085348
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +WT+eEd  l ++  + G+++W+++a+ m+ +R++ qc++rw+++l
  LOC_Os06g14700.1 40 AWTPEEDAALERLAVENGSRHWRRVAAQMPRKRSPVQCRDRWRDHL 85
                      6*****************************99***********986 PP

2Myb_DNA-binding22.52.6e-0793136345
                       SS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwq 45 
                       + T+ +d+ l ++v + Ggg  +Wk I+r +  gR+  ++k rw 
  LOC_Os06g14700.1  93 PYTAADDDELTRLVLRPGGGgdRWKDISRAVH-GRSSRSVKRRWM 136
                       679999999*********99************.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.9153389IPR017930Myb domain
SMARTSM007176.2E-123787IPR001005SANT/Myb domain
SuperFamilySSF466894.21E-2039135IPR009057Homeodomain-like
PfamPF002492.0E-144085IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-164097IPR009057Homeodomain-like
CDDcd001676.77E-124085No hitNo description
SMARTSM007170.01790141IPR001005SANT/Myb domain
CDDcd001671.07E-493138No hitNo description
PROSITE profilePS500907.14393139IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.0E-798137IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MAMMEPSSSS SSSTASAVTP SSAPPSGRCC VVLRIKLPAA WTPEEDAALE RLAVENGSRH  60
WRRVAAQMPR KRSPVQCRDR WRDHLARDVF HRPYTAADDD ELTRLVLRPG GGGDRWKDIS  120
RAVHGRSSRS VKRRWMEIGT SDELLRKLAP PVIDAVSGHG GGRRRLMRPN QAFGWRRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osf_A1e-15321401108MYB21
3osf_D1e-15321401108MYB21
3osg_A1e-15321401108MYB21
3osg_D1e-15321401108MYB21
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ652S8
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g14700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g14700
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0055270.0AP005527.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0603C10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642266.11e-126PREDICTED: transcription factor MYB44-like
TrEMBLI1Q1C31e-126I1Q1C3_ORYGL; Uncharacterized protein
TrEMBLQ652S81e-126Q652S8_ORYSJ; Myb-like transcription factor-like
STRINGLOC_Os06g14700.11e-125(Oryza sativa Japonica Group)
STRINGORGLA06G0093600.11e-125(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10428310
MonocotsOGMP83601346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.13e-17myb domain protein r1