PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g14670.1
Common NameLOC4340683, Os06g0258000, OsJ_20870, OSNPB_060258000, P0603C10.20, P0624H09.43
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB
Protein Properties Length: 268aa    MW: 29556.4 Da    PI: 4.8493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g14670.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-161461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++lv     +G  +W+ +++  g+ R++k+c++rw +yl
  LOC_Os06g14670.1 14 KGPWTAEEDQKLVAFLLTHGHCCWRVVPKLAGLLRCGKSCRLRWTNYL 61
                      79******************************99************97 PP

2Myb_DNA-binding53.36.2e-1771111547
                       -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       + +E+ l +d+++qlG++ W++Ia++++ gRt++++k++w+++
  LOC_Os06g14670.1  71 SDDEERLVIDLHAQLGNR-WSKIAARLP-GRTDNEIKNHWNTH 111
                       899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.0E-21562IPR009057Homeodomain-like
PROSITE profilePS5129414.227961IPR017930Myb domain
SuperFamilySSF466893.03E-2711108IPR009057Homeodomain-like
SMARTSM007177.3E-131363IPR001005SANT/Myb domain
PfamPF002492.1E-141461IPR001005SANT/Myb domain
CDDcd001671.45E-91661No hitNo description
PROSITE profilePS5129427.50362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2463116IPR009057Homeodomain-like
SMARTSM007172.5E-1566114IPR001005SANT/Myb domain
CDDcd001677.55E-1271112No hitNo description
PfamPF002491.1E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009066anatomyanther
PO:0001004developmental stageanther development stage
PO:0007130developmental stagesporophyte reproductive stage
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDQKLVAFLL THGHCCWRVV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDDEERLVID LHAQLGNRWS KIAARLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPVTHQPLE PPRPPPREQD ATPPPPPPPP QEIEESEEEE QEPSPLIEPH EITAPPPAAA  180
AEAATSNCSV SPASVLSPSC SSSASAASAV DVAEWPEPMY MFGMDGIMDV GWNGLISGAG  240
VDVDVDVDPF DHYYHDASFD DQDVWII*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-30121165108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.550960.0panicle
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2844317950.0
Expression AtlasQ652E6-
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g14670.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g14670
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ9402170.0FJ940217.1 Oryza sativa Japonica Group clone KCS132B07 Myb related transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642105.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX68e-85ODO1_PETHY; Protein ODORANT1
TrEMBLQ652E60.0Q652E6_ORYSJ; Myb related transcription factor
STRINGLOC_Os06g14670.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-81myb domain protein 20