PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LOC_Os06g14010.1
Common NameLOC107275538, Os06g0250760, OSJNBa0091G06.33, OSNPB_060250760, P0431E05.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family MYB_related
Protein Properties Length: 170aa    MW: 19018.5 Da    PI: 11.2881
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LOC_Os06g14010.1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.86.6e-153680347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      +WT+eEd  l ++  ++G+++W+++a+ m+ +R++ qc++rw ++
  LOC_Os06g14010.1 36 AWTPEEDAVLERLAMEHGSRHWRRVAAQMPRRRSPAQCRDRWGDH 80
                      7*****************************************655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1912985IPR017930Myb domain
SMARTSM007172.3E-113383IPR001005SANT/Myb domain
SuperFamilySSF466891.8E-1734136IPR009057Homeodomain-like
CDDcd001672.49E-113677No hitNo description
Gene3DG3DSA:1.10.10.607.0E-183691IPR009057Homeodomain-like
PfamPF002494.5E-143680IPR001005SANT/Myb domain
SMARTSM007170.5986142IPR001005SANT/Myb domain
PROSITE profilePS500905.78489140IPR017877Myb-like domain
PfamPF139213.8E-590141No hitNo description
Gene3DG3DSA:1.10.10.601.6E-592139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MDMELSSSSS STTVASSPAS SPPLGRCVLR FRLPPAWTPE EDAVLERLAM EHGSRHWRRV  60
AAQMPRRRSP AQCRDRWGDH LARDVFHRPF TAADDAELAR LCLRLDDDAG FAAGRRWKDV  120
SRAVYGRSSC AVKRRWRELR RSDAFLGALW RPRTTTTAPP ANAAITTTC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3osf_A1e-153713614103MYB21
3osf_D1e-153713614103MYB21
3osg_A1e-153713614103MYB21
3osg_D1e-153713614103MYB21
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasQ653P2
Cis-element ? help Back to Top
SourceLink
PlantRegMapLOC_Os06g14010.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
RiceGEOs06g14010
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126140.0CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankAP0051070.0AP005107.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0431E05.
GenBankAP0046510.0AP004651.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0091G06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642261.11e-117PREDICTED: transcription factor MYB44-like
TrEMBLA2YBA81e-117A2YBA8_ORYSI; Putative uncharacterized protein
TrEMBLQ653P21e-117Q653P2_ORYSJ; Myb-like transcription factor-like
STRINGBGIOSGA021532-PA1e-117(Oryza sativa Indica Group)
STRINGLOC_Os06g14010.11e-117(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP10428310
MonocotsOGMP83601346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-13myb domain protein 73